KEGG   Homo sapiens (human): 5196
Entry
5196              CDS       T01001                                 
Symbol
PF4, CXCL4, PF-4, SCYB4
Name
(RefSeq) platelet factor 4
  KO
K05407  platelet factor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01241  CXCL4/9/10/11/13 to CXCR3/5 signaling
N01242  CXCL4 to KSHV vGPCR signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    5196 (PF4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    5196 (PF4)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    5196 (PF4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    5196 (PF4)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    5196 (PF4)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   5196 (PF4)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Chemokines
   5196 (PF4)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 5196
NCBI-ProteinID: NP_002610
OMIM: 173460
HGNC: 8861
Ensembl: ENSG00000163737
Pharos: P02776(Tbio)
UniProt: P02776
Structure
LinkDB
Position
4:complement(73980811..73982124)
AA seq 101 aa
MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEV
IKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
NT seq 306 nt   +upstreamnt  +downstreamnt
atgagctccgcagccgggttctgcgcctcacgccccgggctgctgttcctggggttgctg
ctcctgccacttgtggtcgccttcgccagcgctgaagctgaagaagatggggacctgcag
tgcctgtgtgtgaagaccacctcccaggtccgtcccaggcacatcaccagcctggaggtg
atcaaggccggaccccactgccccactgcccaactgatagccacgctgaagaatggaagg
aaaatttgcttggacctgcaagccccgctgtacaagaaaataattaagaaacttttggag
agttag

KEGG   Homo sapiens (human): 5197
Entry
5197              CDS       T01001                                 
Symbol
PF4V1, CXCL4L1, CXCL4V1, PF4-ALT, PF4A, SCYB4V1
Name
(RefSeq) platelet factor 4 variant 1
  KO
K05407  platelet factor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    5197 (PF4V1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    5197 (PF4V1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    5197 (PF4V1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    5197 (PF4V1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    5197 (PF4V1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   5197 (PF4V1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Chemokines
   5197 (PF4V1)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 5197
NCBI-ProteinID: NP_002611
OMIM: 173461
HGNC: 8862
Ensembl: ENSG00000109272
Pharos: P10720(Tbio)
UniProt: P10720
Structure
LinkDB
Position
4:73853296..73854483
AA seq 104 aa
MSSAARSRLTRATRQEMLFLALLLLPVVVAFARAEAEEDGDLQCLCVKTTSQVRPRHITS
LEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLES
NT seq 315 nt   +upstreamnt  +downstreamnt
atgagctccgcagccaggtcccgcctcacccgcgccacccgccaggagatgctgttcttg
gcgttgctgctcctgccagttgtggtcgccttcgccagagctgaagctgaagaagatggg
gacctgcagtgcctgtgtgtgaagaccacctcccaggtccgtcccaggcacatcaccagc
ctggaggtgatcaaggccggaccccactgccccactgcccaactcatagccacgctgaag
aatgggaggaaaatttgcttggatctgcaagccctgctgtacaagaaaatcattaaggaa
catttggagagttag

DBGET integrated database retrieval system