KEGG   Homo sapiens (human): 5286
Entry
5286              CDS       T01001                                 
Symbol
PIK3C2A, CPK, OCSKD, PI3-K-C2(ALPHA), PI3-K-C2A, PI3K-C2-alpha, PI3K-C2alpha
Name
(RefSeq) phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 alpha
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5286 (PIK3C2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    5286 (PIK3C2A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    5286 (PIK3C2A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     5286 (PIK3C2A)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PI3K_rbd C2 PX DUF4135
Other DBs
NCBI-GeneID: 5286
NCBI-ProteinID: NP_001308307
OMIM: 603601
HGNC: 8971
Ensembl: ENSG00000011405
Vega: OTTHUMG00000166036
Pharos: O00443(Tchem)
UniProt: O00443 L7RRS0
Structure
LinkDB
Position
11:complement(17086575..17207986)
AA seq 1686 aa
MAQISSNSGFKECPSSHPEPTRAKDVDKEEALQMEAEALAKLQKDRQVTDNQRGFELSSS
TRKKAQVYNKQDYDLMVFPESDSQKRALDIDVEKLTQAELEKLLLDDSFETKKTPVLPVT
PILSPSFSAQLYFRPTIQRGQWPPGLPGPSTYALPSIYPSTYSKQAAFQNGFNPRMPTFP
STEPIYLSLPGQSPYFSYPLTPATPFHPQGSLPIYRPVVSTDMAKLFDKIASTSEFLKNG
KARTDLEITDSKVSNLQVSPKSEDISKFDWLDLDPLSKPKVDNVEVLDHEEEKNVSSLLA
KDPWDAVLLEERSTANCHLERKVNGKSLSVATVTRSQSLNIRTTQLAKAQGHISQKDPNG
TSSLPTGSSLLQEVEVQNEEMAAFCRSITKLKTKFPYTNHRTNPGYLLSPVTAQRNICGE
NASVKVSIDIEGFQLPVTFTCDVSSTVEIIIMQALCWVHDDLNQVDVGSYVLKVCGQEEV
LQNNHCLGSHEHIQNCRKWDTEIRLQLLTFSAMCQNLARTAEDDETPVDLNKHLYQIEKP
CKEAMTRHPVEELLDSYHNQVELALQIENQHRAVDQVIKAVRKICSALDGVETLAITESV
KKLKRAVNLPRSKTADVTSLFGGEDTSRSSTRGSLNPENPVQVSINQLTAAIYDLLRLHA
NSGRSPTDCAQSSKSVKEAWTTTEQLQFTIFAAHGISSNWVSNYEKYYLICSLSHNGKDL
FKPIQSKKVGTYKNFFYLIKWDELIIFPIQISQLPLESVLHLTLFGILNQSSGSSPDSNK
QRKGPEALGKVSLPLFDFKRFLTCGTKLLYLWTSSHTNSVPGTVTKKGYVMERIVLQVDF
PSPAFDIIYTTPQVDRSIIQQHNLETLENDIKGKLLDILHKDSSLGLSKEDKAFLWEKRY
YCFKHPNCLPKILASAPNWKWVNLAKTYSLLHQWPALYPLIALELLDSKFADQEVRSLAV
TWIEAISDDELTDLLPQFVQALKYEIYLNSSLVQFLLSRALGNIQIAHNLYWLLKDALHD
VQFSTRYEHVLGALLSVGGKRLREELLKQTKLVQLLGGVAEKVRQASGSARQVVLQRSME
RVQSFFQKNKCRLPLKPSLVAKELNIKSCSFFSSNAVPLKVTMVNADPMGEEINVMFKVG
EDLRQDMLALQMIKIMDKIWLKEGLDLRMVIFKCLSTGRDRGMVELVPASDTLRKIQVEY
GVTGSFKDKPLAEWLRKYNPSEEEYEKASENFIYSCAGCCVATYVLGICDRHNDNIMLRS
TGHMFHIDFGKFLGHAQMFGSFKRDRAPFVLTSDMAYVINGGEKPTIRFQLFVDLCCQAY
NLIRKQTNLFLNLLSLMIPSGLPELTSIQDLKYVRDALQPQTTDAEATIFFTRLIESSLG
SIATKFNFFIHNLAQLRFSGLPSNDEPILSFSPKTYSFRQDGRIKEVSVFTYHKKYNPDK
HYIYVVRILREGQIEPSFVFRTFDEFQELHNKLSIIFPLWKLPGFPNRMVLGRTHIKDVA
AKRKIELNSYLQSLMNASTDVAECDLVCTFFHPLLRDEKAEGIARSADAGSFSPTPGQIG
GAVKLSISYRNGTLFIMVMHIKDLVTEDGADPNPYVKTYLLPDNHKTSKRKTKISRKTRN
PTFNEMLVYSGYSKETLRQRELQLSVLSAESLRENFFLGGVTLPLKDFNLSKETVKWYQL
TAATYL
NT seq 5061 nt   +upstreamnt  +downstreamnt
atggctcagatatctagcaacagcggatttaaagaatgtccatcttcacatccggaacca
acaagagcaaaagatgtggacaaagaagaagcattacagatggaagcagaggctttagca
aaactgcaaaaggatagacaagtgactgacaatcagagaggctttgagttgtcaagcagc
accagaaaaaaagcacaggtttataacaagcaggattatgatctcatggtgtttcctgaa
tcagattcccaaaaaagagcattagatattgatgtagaaaagctcacccaagctgaactt
gagaaactattgctggatgacagtttcgagactaaaaaaacacctgtattaccagttact
cctattctgagcccttccttttcagcacagctctattttagacctactattcagagagga
cagtggccacctggattacctgggccttccacttatgctttaccttctatttatccttct
acttacagtaaacaggctgcattccaaaatggcttcaatccaagaatgcccacttttcca
tctacagaacctatatatttaagtcttccgggacaatctccatatttctcatatcctttg
acacctgccacaccctttcatccacaaggaagcttacctatctatcgtccagtagtcagt
actgacatggcaaaactatttgacaaaatagctagtacatcagaatttttaaaaaatggg
aaagcaaggactgatttggagataacagattcaaaagtcagcaatctacaggtatctcca
aagtctgaggatatcagtaaatttgactggttagacttggatcctctaagtaagcctaag
gtggataatgtggaggtattagaccatgaggaagagaaaaatgtttcaagtttgctagca
aaggatccttgggatgctgttcttcttgaagagagatcgacagcaaattgtcatcttgaa
agaaaggtgaatggaaaatccctttctgtggcaactgttacaagaagccagtctttaaat
attcgaacaactcagcttgcaaaagcccagggccatatatctcagaaagacccaaatggg
accagtagtttgccaactggaagttctcttcttcaagaagttgaagtacagaatgaggag
atggcagctttttgtcgatccattacaaaattgaagaccaaatttccatataccaatcac
cgcacaaacccaggctatttgttaagtccagtcacagcacaaagaaacatatgcggagaa
aatgctagtgtgaaggtctccattgacattgaaggatttcagctaccagttacttttacg
tgtgatgtgagttctactgtagaaatcattataatgcaagccctttgctgggtacatgat
gacttgaatcaagtagatgttggcagctatgttctaaaagtttgtggtcaagaggaagtg
ctgcagaataatcattgccttggaagtcatgagcatattcaaaactgtcgaaaatgggac
acagaaattagactacaactcttgaccttcagtgcaatgtgtcaaaatctggcccgaaca
gcagaagatgatgaaacacccgtggatttaaacaaacacctgtatcaaatagaaaaacct
tgcaaagaagccatgacgagacaccctgttgaagaactcttagattcttatcacaaccaa
gtagaactggctcttcaaattgaaaaccaacaccgagcagtagatcaagtaattaaagct
gtaagaaaaatctgtagtgctttagatggtgtcgagactcttgccattacagaatcagta
aagaagctaaagagagcagttaatcttccaaggagtaaaactgctgatgtgacttctttg
tttggaggagaagacactagcaggagttcaactaggggctcacttaatcctgaaaatcct
gttcaagtaagcataaaccaattaactgcagcaatttatgatcttctcagactccatgca
aattctggtaggagtcctacagactgtgcccaaagtagcaagagtgtcaaggaagcatgg
actacaacagagcagctccagtttactatttttgctgctcatggaatttcaagtaattgg
gtatcaaattatgaaaaatactacttgatatgttcactgtctcacaatggaaaggatctt
tttaaacctattcaatcaaagaaggttggcacttacaagaatttcttctatcttattaaa
tgggatgaactaatcatttttcctatccagatatcacaattgccattagaatcagttctt
caccttactctttttggaattttaaatcagagcagtggaagttcccctgattctaataag
cagagaaagggaccagaagctttgggcaaagtttctttacctctttttgactttaaacgg
tttttaacatgtggaactaaacttctatatctttggacttcatcacatacaaattctgtt
cctggaacagttaccaaaaaaggatatgtcatggaaagaatagtgctacaggttgatttt
ccttctcctgcatttgatattatttatacaactcctcaagttgacagaagcattatacag
caacataacttagaaacactagagaatgatataaaagggaaacttcttgatattcttcat
aaagactcatcacttggactttctaaagaagataaagcttttttatgggagaaacgttat
tattgcttcaaacacccaaattgtcttcctaaaatattagcaagcgccccaaactggaaa
tgggttaatcttgccaaaacttactcattgcttcaccagtggcctgcattgtacccacta
attgcattggaacttcttgattcaaaatttgctgatcaggaagtaagatccctagctgtg
acctggattgaggccattagtgatgatgagctaacagatcttcttccacagtttgtacaa
gctttgaaatatgaaatttacttgaatagttcattagtgcaattccttttgtccagggca
ttgggaaatatccagatagcacacaatttatattggcttctcaaagatgccctgcatgat
gtacagtttagtacccgatacgaacatgttttgggtgctctcctgtcagtaggaggaaaa
cgacttagagaagaacttctaaaacagacgaaacttgtacagcttttaggaggagtagca
gaaaaagtaaggcaggctagtggatcagccagacaggttgttctccaaagaagtatggaa
cgagtacagtccttttttcagaaaaataaatgccgtctccctctcaagccaagtctagtg
gcaaaagaattaaatattaagtcgtgttccttcttcagttctaatgctgtccccctaaaa
gtcacaatggtgaatgctgaccctatgggagaagaaattaatgtcatgtttaaggttggt
gaagatcttcggcaagatatgttagctttacagatgataaagattatggataagatctgg
cttaaagaaggactagatctgaggatggtaattttcaaatgtctctcaactggcagagat
cgaggcatggtggagctggttcctgcttccgataccctcaggaaaatccaagtggaatat
ggtgtgacaggatcctttaaagataaaccacttgcagagtggctaaggaaatacaatccc
tctgaagaagaatatgaaaaggcttcagagaactttatctattcctgtgctggatgctgt
gtagccacctatgttttaggcatctgtgatcgacacaatgacaatataatgcttcgaagc
acgggacacatgtttcacattgactttggaaagtttttgggacatgcacagatgtttggc
agcttcaaaagggatcgggctccttttgtgctgacctctgatatggcatatgtcattaat
gggggtgaaaagcccaccattcgttttcagttgtttgtggacctctgctgtcaggcctac
aacttgataagaaagcagacaaacctttttcttaacctcctttcactgatgattccttca
gggttaccagaacttacaagtattcaagatttgaaatacgttagagatgcacttcaaccc
caaactacagacgcagaagctacaattttctttactaggcttattgaatcaagtttggga
agcattgccacaaagtttaacttcttcattcacaaccttgctcagcttcgtttttctggt
cttccttctaatgatgagcccatcctttcattttcacctaaaacatactcctttagacaa
gatggtcgaatcaaggaagtctctgtttttacatatcataagaaatacaacccagataaa
cattatatttatgtagtccgaattttgagggaaggacagattgaaccatcatttgtcttc
cgaacatttgacgaatttcaggaacttcacaataagctcagtattatttttccactttgg
aagttaccaggctttcctaataggatggttctaggaagaacacacataaaagatgtagca
gccaaaaggaaaattgagttaaacagttacttacagagtttgatgaatgcttcaacggat
gtagcagagtgtgatcttgtttgtactttcttccaccctttacttcgtgatgagaaagct
gaagggatagctaggtctgcagatgcaggttccttcagtcctactccaggccaaatagga
ggagctgtgaaattatccatctcttaccgaaatggtactcttttcatcatggtgatgcat
atcaaagatcttgttactgaagatggagctgacccaaatccatatgtcaaaacataccta
cttccagataaccacaaaacatccaaacgtaaaaccaaaatttcacgaaaaacgaggaat
ccgacattcaatgaaatgcttgtatacagtggatatagcaaagaaaccctaagacagcga
gaacttcaactaagtgtactcagtgcagaatctctgcgggagaattttttcttgggtgga
gtaaccctgcctttgaaagatttcaacttgagcaaagagacggttaaatggtatcagctg
actgcggcaacatacttgtaa

KEGG   Homo sapiens (human): 5287
Entry
5287              CDS       T01001                                 
Symbol
PIK3C2B, C2-PI3K
Name
(RefSeq) phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 beta
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa05132  Salmonella infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01129  Salmonella SopB to ARNO-ARF-ACTB/G signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5287 (PIK3C2B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    5287 (PIK3C2B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    5287 (PIK3C2B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     5287 (PIK3C2B)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PI3K_rbd C2 PX DUF4135 HEAT_2
Other DBs
NCBI-GeneID: 5287
NCBI-ProteinID: NP_002637
OMIM: 602838
HGNC: 8972
Ensembl: ENSG00000133056
Vega: OTTHUMG00000036101
Pharos: O00750(Tchem)
UniProt: O00750 A2RUF7 Q4LE65
LinkDB
Position
1:complement(204422633..204494805)
AA seq 1634 aa
MSSTQGNGEHWKSLESVGISRKELAMAEALQMEYDALSRLRHDKEENRAKQNADPSLISW
DEPGVDFYSKPAGRRTDLKLLRGLSGSDPTLNYNSLSPQEGPPNHSTSQGPQPGSDPWPK
GSLSGDYLYIFDGSDGGVSSSPGPGDIEGSCKKLSPPPLPPRASIWDTPPLPPRKGSPSS
SKISQPSDINTFSLVEQLPGKLLEHRILEEEEVLGGGGQGRLLGSVDYDGINDAITRLNL
KSTYDAEMLRDATRGWKEGRGPLDFSKDTSGKPVARSKTMPPQVPPRTYASRYGNRKNAT
PGKNRRISAAPVGSRPHTVANGHELFEVSEERDEEVAAFCHMLDILRSGSDIQDYFLTGY
VWSAVTPSPEHLGDEVNLKVTVLCDRLQEALTFTCNCSSTVDLLIYQTLCYTHDDLRNVD
VGDFVLKPCGLEEFLQNKHALGSHEYIQYCRKFDIDIRLQLMEQKVVRSDLARTVNDDQS
PSTLNYLVHLQERPVKQTISRQALSLLFDTYHNEVDAFLLADGDFPLKADRVVQSVKAIC
NALAAVETPEITSALNQLPPCPSRMQPKIQKDPSVLAVRENREKVVEALTAAILDLVELY
CNTFNADFQTAVPGSRKHDLVQEACHFARSLAFTVYATHRIPIIWATSYEDFYLSCSLSH
GGKELCSPLQTRRAHFSKYLFHLIVWDQQICFPVQVNRLPRETLLCATLYALPIPPPGSS
SEANKQRRVPEALGWVTTPLFNFRQVLTCGRKLLGLWPATQENPSARWSAPNFHQPDSVI
LQIDFPTSAFDIKFTSPPGDKFSPRYEFGSLREEDQRKLKDIMQKESLYWLTDADKKRLW
EKRYYCHSEVSSLPLVLASAPSWEWACLPDIYVLLKQWTHMNHQDALGLLHATFPDQEVR
RMAVQWIGSLSDAELLDYLPQLVQALKYECYLDSPLVRFLLKRAVSDLRVTHYFFWLLKD
GLKDSQFSIRYQYLLAALLCCCGKGLREEFNRQCWLVNALAKLAQQVREAAPSARQGILR
TGLEEVKQFFALNGSCRLPLSPSLLVKGIVPRDCSYFNSNAVPLKLSFQNVDPLGENIRV
IFKCGDDLRQDMLTLQMIRIMSKIWVQEGLDMRMVIFRCFSTGRGRGMVEMIPNAETLRK
IQVEHGVTGSFKDRPLADWLQKHNPGEDEYEKAVENFIYSCAGCCVATYVLGICDRHNDN
IMLKTTGHMFHIDFGRFLGHAQMFGNIKRDRAPFVFTSDMAYVINGGDKPSSRFHDFVDL
CCQAYNLIRKHTHLFLNLLGLMLSCGIPELSDLEDLKYVYDALRPQDTEANATTYFTRLI
ESSLGSVATKLNFFIHNLAQMKFTGSDDRLTLSFASRTHTLKSSGRISDVFLCRHEKIFH
PNKGYIYVVKVMRENTHEATYIQRTFEEFQELHNKLRLLFPSSHLPSFPSRFVIGRSRGE
AVAERRREELNGYIWHLIHAPPEVAECDLVYTFFHPLPRDEKAMGTSPAPKSSDGTWARP
VGKVGGEVKLSISYKNNKLFIMVMHIRGLQLLQDGNDPDPYVKIYLLPDPQKTTKRKTKV
ARKTCNPTYNEMLVYDGIPKGDLQQRELQLSVLSEQGFWENVLLGEVNIRLRELDLAQEK
TGWFALGSRSHGTL
NT seq 4905 nt   +upstreamnt  +downstreamnt
atgtcttcgactcagggcaatggggaacactggaagtccctggagtcagtgggcatcagc
cgcaaagagctagcgatggccgaagccctgcagatggagtatgatgccctgtcccggctc
cggcatgacaaggaggagaacagagccaagcagaacgcagacccctctctcatcagctgg
gatgagcctggggtagacttttacagcaagccagcaggaaggcggaccgacctcaagctg
ttacgcggtctctctggctctgatcctacccttaactacaactcactctccccacaggaa
gggccgcccaaccactctacctcccaagggccacagcctggctcagatccctggcccaaa
ggctccctgtctggagactatctctacatttttgatggttcagatgggggagtctcttcg
tccccaggaccaggggacatagagggctcttgcaagaaactatccccacctcctctgcct
ccccgagcttctatctgggatacccctcccctgcctcccagaaaggggtccccctcatcc
tccaagatctcccagcccagtgacatcaacactttctctttggtcgaacaattgccgggc
aaactgctagagcatcggatcctagaagaggaagaggtgctgggaggtgggggtcagggg
cgcctactggggtctgtggactatgatggtatcaatgatgcaattactaggctcaacttg
aaatcgacctatgatgcggagatgttgcgggatgccaccaggggctggaaggagggccga
gggccgctggacttcagcaaagacacctctggaaaacccgtggccaggagcaagactatg
ccccctcaggtgcccccccgcacctatgcctcccgctatggcaaccgaaagaatgcgacg
cctggcaagaaccgccggatttctgcagccccggtgggctcccggccccacactgttgcc
aatggccatgagttgtttgaggtctcagaagagagagatgaggaggttgctgcattttgc
cacatgctggatatccttcgatctggctctgacatccaagactacttcctcactggctat
gtctggagtgctgtcacccctagcccagagcacctcggggatgaggtcaacctgaaggtg
actgtgttgtgtgacaggcttcaagaggcactcactttcacctgcaactgttcctccact
gtagacttgcttatctaccagaccctgtgctacacccatgatgacctgaggaatgtggac
gtgggtgactttgtgctaaagccctgcgggctggaggagttcctgcagaacaagcatgcc
ttgggcagtcatgagtacatccaatactgccgcaagtttgacattgacattcggctacag
ctgatggagcagaaggttgtgcgcagtgacctggcccggacggtgaatgatgaccagagc
ccctccaccttgaactacctcgtccatctccaagagaggcctgtcaagcagaccatcagc
aggcaggccctgagtcttctgttcgacacttaccacaatgaggtggatgccttcctgctg
gctgatggagacttcccactgaaggctgacagggtggtccagtccgtcaaggccatctgc
aacgccctggccgccgtggaaacccctgagatcaccagtgctctcaaccagctgcccccc
tgcccctcccgcatgcagcctaaaattcagaaggatcccagtgtcttggctgtgagggaa
aaccgagagaaggtcgtggaagccctgaccgctgccatcttggacctggtggagctgtac
tgcaacacattcaacgcagacttccagacggcagtgcccgggagccgcaagcatgacctg
gtccaggaggcctgccatttcgccaggtccctggccttcactgtctatgccacccaccgc
atccccatcatctgggctaccagctatgaagatttctacctctcctgctccctcagccat
ggcggcaaggagctgtgcagccccctgcagacccgaagagctcacttctccaagtacctc
ttccacctcatcgtctgggaccagcagatctgcttcccagtgcaggtgaaccggctgcct
cgggagacactgctgtgtgccactctctatgctctgcccatccccccaccggggagctcc
tcagaggccaataagcagcggcgggtgcctgaagccctgggctgggtcactaccccactc
ttcaacttcaggcaggtcctgacctgtggccggaagcttctgggtttgtggccagcaaca
caggaaaatcccagcgcccgttggagtgcacctaatttccaccagccagacagtgtcatc
ctgcagattgacttccccacctcggcctttgacatcaagttcaccagcccccctggagac
aagttcagcccccgctatgagtttggcagcctccgggaagaagaccagcgcaagcttaaa
gacatcatgcagaaagagtccttgtactggctcactgatgctgacaagaagcgcctgtgg
gagaagcgatattactgccactcggaggtgagctcgctccccctggtgctcgccagcgcc
cccagctgggagtgggcttgcctgcctgacatctatgttctcctgaagcagtggacccac
atgaaccaccaggatgccctggggctcctgcatgccaccttcccggaccaggaggtgcgt
cgtatggctgtgcagtggattggctcactctcagatgctgagctgctagactacctgccc
cagctggtacaggccctgaagtatgaatgctacctggacagcccgttggtgcgcttcctc
ctgaaacgagctgtgtctgacttgagagtgactcactacttcttctggttactgaaggac
ggcctcaaggactctcagttcagcatccgctaccagtatctgctggcagccttactgtgc
tgctgtggcaaggggctgagagaagagtttaaccgccagtgctggcttgtcaatgccctg
gccaaactggcccagcaggtccgggaggcagccccatctgcaaggcagggaatcctccgc
acgggcctggaggaggtgaagcagttctttgccctcaatggctcgtgccgcttgccactc
agccccagtctgctggttaagggaattgtgcccagggactgttcctacttcaactccaat
gctgtccccctcaaactctccttccaaaatgtggatcccctgggtgagaacatccgtgtc
atcttcaagtgtggggacgaccttcgccaggacatgctaacgctgcagatgattcgcatc
atgagcaagatctgggtccaggaggggctggacatgcgcatggtcatcttccgctgcttc
tccaccggccggggcagagggatggtggagatgatccctaatgctgagaccctgcgtaag
atccaggtggagcatggggtgaccggctcgttcaaggaccggcccctggcagactggctg
cagaaacacaaccctggggaggacgagtatgagaaggctgtggagaactttatctactcc
tgcgctggctgctgcgtggccacgtacgtcttgggcatctgtgaccgacataatgacaac
atcatgctgaagaccactggtcacatgttccacattgattttggccgcttcctgggccat
gcccagatgtttggcaacatcaagcgggaccgtgccccctttgtcttcacctcggacatg
gcgtatgtcatcaacgggggtgacaagccttccagccgcttccatgattttgttgacctt
tgctgccaagcctacaacctcattcgcaagcacacccacctcttcctcaaccttctgggc
ctgatgttgtcctgtgggatccctgaactctcagacctggaggacctcaagtatgtgtac
gatgccctgaggcctcaggatacagaggccaatgccactacctacttcactaggttgatt
gagtccagcctgggcagtgtagccacaaagctcaattttttcatccataatctggctcag
atgaagttcacgggctcagatgaccggctgaccctctcctttgcctcccgaacacacact
ctcaagagctctggccgaatcagtgatgttttcctctgccgccatgagaagatcttccac
cccaacaaaggctatatatatgtggtaaaggtgatgcgagagaacactcacgaggccacc
tacatccagcggacctttgaggagttccaggaattacacaataagttgcggctgctcttc
ccttcttcccacttgcccagcttccctagtcgcttcgtgatcggccgctcccggggagag
gcggtggccgagcggcggagggaggagctaaacggttacatctggcacttgatccacgca
ccccctgaggtggccgagtgtgatttggtgtacaccttcttccacccactgccccgggat
gagaaggctatgggcaccagcccagctcctaagtcctcagatggcacatgggcccggccc
gtcggaaaggtgggaggggaggtgaagctgtccatctcctacaaaaacaataaactcttc
atcatggtgatgcatattcggggcttgcaactgctccaggatggaaatgaccctgacccc
tatgtgaaaatttacctccttcctgaccctcagaaaaccactaagaggaaaaccaaagtg
gcccggaaaacctgcaatcctacctacaatgagatgttggtatatgatgggatccccaag
ggtgacctgcagcagcgggagctccagctgagcgtgctgagtgagcagggattctgggag
aacgtcctcctcggtgaggtgaacatccgcctgcgagagctggacctggctcaggagaag
accggctggttcgccctgggatctcgaagtcatggcaccttgtga

KEGG   Homo sapiens (human): 5288
Entry
5288              CDS       T01001                                 
Symbol
PIK3C2G, PI3K-C2-gamma, PI3K-C2GAMMA
Name
(RefSeq) phosphatidylinositol-4-phosphate 3-kinase catalytic subunit type 2 gamma
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5288 (PIK3C2G)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    5288 (PIK3C2G)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    5288 (PIK3C2G)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     5288 (PIK3C2G)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PX PI3K_rbd C2 PI3K_C2 DUF4135 Serum_albumin
Other DBs
NCBI-GeneID: 5288
NCBI-ProteinID: NP_004561
OMIM: 609001
HGNC: 8973
Ensembl: ENSG00000139144
Vega: OTTHUMG00000168841
Pharos: O75747(Tbio)
UniProt: O75747 B7ZLY6
Structure
LinkDB
Position
12:18242961..18726817
AA seq 1445 aa
MAYSWQTDPNPNESHEKQYEHQEFLFVNQPHSSSQVSLGFDQIVDEISGKIPHYESEIDE
NTFFVPTAPKWDSTGHSLNEAHQISLNEFTSKSRELSWHQVSKAPAIGFSPSVLPKPQNT
NKECSWGSPIGKHHGADDSRFSILAPSFTSLDKINLEKELENENHNYHIGFESSIPPTNS
SFSSDFMPKEENKRSGHVNIVEPSLMLLKGSLQPGMWESTWQKNIESIGCSIQLVEVPQS
SNTSLASFCNKVKKIRERYHAADVNFNSGKIWSTTTAFPYQLFSKTKFNIHIFIDNSTQP
LHFMPCANYLVKDLIAEILHFCTNDQLLPKDHILSVCGSEEFLQNDHCLGSHKMFQKDKS
VIQLHLQKSREAPGKLSRKHEEDHSQFYLNQLLEFMHIWKVSRQCLLTLIRKYDFHLKYL
LKTQENVYNIIEEVKKICSVLGCVETKQITDAVNELSLILQRKGENFYQSSETSAKGLIE
KVTTELSTSIYQLINVYCNSFYADFQPVNVPRCTSYLNPGLPSHLSFTVYAAHNIPETWV
HRINFPLEIKSLPRESMLTVKLFGIACATNNANLLAWTCLPLFPKEKSILGSMLFSMTLQ
SEPPVEMITPGVWDVSQPSPVTLQIDFPATGWEYMKPDSEENRSNLEEPLKECIKHIARL
SQKQTPLLLSEEKKRYLWFYRFYCNNENCSLPLVLGSAPGWDERTVSEMHTILRRWTFSQ
PLEALGLLTSSFPDQEIRKVAVQQLDNLLNDELLEYLPQLVQAVKFEWNLESPLVQLLLH
RSLQSIQVAHRLYWLLKNAENEAYFKSWYQKLLAALQFCAGKALNDEFSKEQKLIKILGD
IGERVKSASDHQRQEVLKKEIGRLEEFFQDVNTCHLPLNPALCIKGIDHDACSYFTSNAL
PLKITFINANPMGKNISIIFKAGDDLRQDMLVLQLIQVMDNIWLQEGLDMQMIIYRCLST
GKDQGLVQMVPDAVTLAKIHRHSGLIGPLKENTIKKWFSQHNHLKADYEKALRNFFYSCA
GWCVVTFILGVCDRHNDNIMLTKSGHMFHIDFGKFLGHAQTFGGIKRDRAPFIFTSEMEY
FITEGGKNPQHFQDFVELCCRAYNIIRKHSQLLLNLLEMMLYAGLPELSGIQDLKYVYNN
LRPQDTDLEATSHFTKKIKESLECFPVKLNNLIHTLAQMSAISPAKSTSQTFPQESCLLS
TTRSIERATILGFSKKSSNLYLIQVTHSNNETSLTEKSFEQFSKLHSQLQKQFASLTLPE
FPHWWHLPFTNSDHRRFRDLNHYMEQILNVSHEVTNSDCVLSFFLSEAVQQTVEESSPVY
LGEKFPDKKPKVQLVISYEDVKLTILVKHMKNIHLPDGSAPSAHVEFYLLPYPSEVRRRK
TKSVPKCTDPTYNEIVVYDEVTELQGHVLMLIVKSKTVFVGAINIRLCSVPLDKEKWYPL
GNSII
NT seq 4338 nt   +upstreamnt  +downstreamnt
atggcatattcttggcaaacggatccaaatcctaatgaatcacacgaaaagcagtatgaa
caccaagaatttctctttgtaaatcaaccccattcttctagccaagtcagtctgggtttt
gatcagatagtagatgagatcagtggcaaaattccacactacgagagtgaaattgatgaa
aacaccttttttgtgcccactgcaccaaaatgggactcaacagggcattcattaaatgaa
gcacaccaaatatccttgaatgaattcacttctaaaagccgtgaactctcctggcatcaa
gttagcaaagcaccagcaattggttttagtccttctgtgttaccaaaacctcaaaatacg
aataaagaatgctcctggggaagccccataggaaaacatcatggtgctgatgattccaga
ttcagtattttagctccatcattcacaagtttggataaaattaatctagagaaagaatta
gaaaatgaaaatcataactaccatataggatttgaaagtagcattcctccaacaaattca
tccttctcaagtgacttcatgccgaaagaagagaataaaaggagtggacatgtgaacatt
gtggaaccatctttgatgcttttgaaaggctctcttcaacccggaatgtgggaaagtaca
tggcagaagaatatagagtcaataggttgttccattcagctagtggaagtacctcaaagc
agcaatacgagtctggcctctttttgcaacaaagtaaaaaaaatcagagaaagatatcat
gcagctgatgttaatttcaattctgggaagatctggagcactactacagcatttccgtat
cagctcttttctaagaccaagtttaatatacatatttttattgataactcaacacaacct
cttcattttatgccatgtgctaattatcttgtcaaagatctaattgcagaaattctgcat
ttttgcacaaatgaccagctactccccaaagatcatattctaagtgtatgtggctctgaa
gaatttttacaaaacgaccactgtttggggagccacaaaatgtttcaaaaagataaatct
gttattcagctccacctgcagaaaagtagggaagctccaggaaagctatctcgaaagcat
gaagaggaccacagtcagttttatctgaatcaacttctagaatttatgcatatttggaaa
gtatccagacaatgtctcttaacactcatcagaaaatatgacttccacctgaaataccta
ttgaaaacccaggaaaacgtgtataatattattgaagaagttaaaaaaatatgcagtgtt
ctagggtgtgtggaaaccaaacaaattacagatgcagtaaatgaactaagtctaattctt
cagagaaaaggagagaatttttatcaaagttcagagacttcagcaaaaggcttgatagag
aaggtaacaactgaactatccacatccatctaccagctaatcaatgtctactgtaacagc
ttttatgcagattttcagcctgtaaatgtacctagatgcacttcctatctaaatcccggg
cttccttcccacctcagcttcacagtgtatgcagcacacaacattccagaaacctgggtg
cacaggatcaattttccccttgaaataaagtcacttccaagggaatccatgctcactgta
aaactgtttgggattgcctgtgcaaccaacaatgcaaatttactggcgtggacttgtctt
ccactgtttccaaaagaaaaatccattctcgggtctatgctgttcagcatgacattacag
agtgagcctcccgtagaaatgataactccaggagtgtgggatgtaagtcagccatccccg
gtgaccctgcagattgattttccagctactgggtgggagtatatgaaacctgattctgaa
gagaatagaagtaatcttgaagagccactaaaggagtgtataaaacatattgccagactt
tcacagaaacagactcccctactactctctgaagaaaagaaaagatatttatggttttat
cgcttctactgcaataatgaaaactgctcccttcctttagtcctgggtagtgcccctgga
tgggatgaaaggactgtttcagaaatgcataccattttgagaagatggacattttctcaa
cctttagaggctcttgggcttttgacttccagttttccagatcaagaaattcgtaaagtg
gcagttcaacaattagacaacctcttgaatgatgaactactggaatatctcccacagcta
gttcaggctgtcaagtttgaatggaaccttgagagtcctttagtgcaacttctactccac
cgctccttgcagagcatccaggttgcccatcgtctttactggctgctaaaaaatgcagaa
aatgaagcttattttaaaagctggtatcagaagctactagctgctctccaattctgtgca
ggtaaagccttgaatgatgagttttccaaggagcagaaacttatcaaaattctgggagat
attggggaaagagtcaagtctgccagtgaccatcaaagacaggaggtactgaagaaagaa
attggcagactagaagagttctttcaagatgtaaatacttgtcatcttcctctgaaccct
gccctatgtataaaagggattgatcacgatgcatgttcatattttacatctaatgctttg
ccattgaagattactttcatcaatgctaatccgatgggcaaaaacatcagcattattttt
aaggctggagatgatcttcgtcaggatatgcttgttctgcagcttattcaagtgatggac
aatatttggctgcaggaaggcttggatatgcaaatgatcatttatagatgtctatccaca
ggaaaagaccaaggattggtgcagatggtacctgatgctgtgaccctagcaaagattcat
cgccattctggactgataggaccattgaaagaaaatacaattaaaaagtggttcagtcag
cacaaccacttaaaggcagattatgaaaaggccttgaggaactttttctactcctgtgct
ggctggtgtgtggtaacattcatcctgggagtatgtgaccgtcacaatgataatatcatg
ctgacaaagtcgggccacatgtttcatattgactttggaaaattcttaggtcatgcacaa
acatttggagggataaaaagggaccgagctcctttcatttttacttcagagatggaatac
tttattacagagggtgggaaaaacccacagcattttcaagattttgtggaactttgctgt
cgtgcttataatattatcagaaagcacagccaactgctcttgaacctgctggaaatgatg
ctgtatgcaggactgcctgagctaagtggaattcaagacctgaaatatgtgtataataat
cttcgtccacaagacacagacctggaagcaacaagtcattttaccaagaaaataaaggaa
agtctggagtgtttccctgttaaattgaataacttgatccacacacttgcacaaatgtca
gccataagccctgccaaatctacttcacagacttttcctcaggaatcctgtttgctgagt
acaactaggtcgattgaaagagcaacaattttagggttcagcaagaaatccagtaatctg
tatctgatccaggtgacacacagcaacaacgaaacaagcctgacagaaaaatcatttgag
cagttttcaaaacttcacagccaacttcagaagcagtttgcatcactgactctcccagag
tttcctcattggtggcacctaccttttacaaattcagatcacagaagattcagagatcta
aatcattacatggaacagatattaaatgtatcacatgaagttacaaacagtgattgtgta
cttagctttttcctctctgaggctgtgcaacaaacagttgaagaatcatcacctgtgtac
ctaggtgagaagtttccagacaagaagcctaaggtgcagttagtcatatcctacgaggat
gtgaagctgaccatactagtgaaacacatgaaaaacattcatctcccagatggctctgcg
cccagtgcacatgttgaattttatcttttaccatatcccagtgaagttcgtaggaggaaa
acaaaatctgttccaaaatgtacggaccccacttacaatgaaattgtagtatatgatgaa
gtcacagagctccaaggacatgtcttaatgcttattgtgaagagtaaaactgtatttgtg
ggagcaattaacatccgactctgtagtgtcccactcgataaagaaaaatggtatccatta
ggaaacagtataatttga

DBGET integrated database retrieval system