KEGG   Homo sapiens (human): 5297
Entry
5297              CDS       T01001                                 

Symbol
PI4KA, PI4K-ALPHA, PIK4CA, PMGYCHA, pi4K230
Name
(RefSeq) phosphatidylinositol 4-kinase alpha
  KO
K00888  phosphatidylinositol 4-kinase A [EC:2.7.1.67]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Disease
H00271  Polymicrogyria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5297 (PI4KA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    5297 (PI4KA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5297 (PI4KA)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.67  1-phosphatidylinositol 4-kinase
     5297 (PI4KA)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Others
   EFR3-PI4KIII alpha complex and associated proteins
    5297 (PI4KA)
 Endosome - Golgi transport
   Others
    5297 (PI4KA)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka Ribosomal_L18_c
Other DBs
NCBI-GeneID: 5297
NCBI-ProteinID: NP_477352
OMIM: 600286
HGNC: 8983
Ensembl: ENSG00000241973
Vega: OTTHUMG00000167440
Pharos: P42356(Tchem)
UniProt: P42356 Q4LE69 B4DYG5
LinkDB
Structure
PDB: 
6BQ1

Position
22q11.21
AA seq 2102 aa
MAAAPARGGGGGGGGGGGCSGSGSSASRGFYFNTVLSLARSLAVQRPASLEKVQKLLCMC
PVDFHGIFQLDERRRDAVIALGIFLIESDLQHKDCVVPYLLRLLKGLPKVYWVEESTARK
GRGALPVAESFSFCLVTLLSDVAYRDPSLRDEILEVLLQVLHVLLGMCQALEIQDKEYLC
KYAIPCLIGISRAFGRYSNMEESLLSKLFPKIPPHSLRVLEELEGVRRRSFNDFRSILPS
NLLTVCQEGTLKRKTSSVSSISQVSPERGMPPPSSPGGSAFHYFEASCLPDGTALEPEYY
FSTISSSFSVSPLFNGVTYKEFNIPLEMLRELLNLVKKIVEEAVLKSLDAIVASVMEANP
SADLYYTSFSDPLYLTMFKMLRDTLYYMKDLPTSFVKEIHDFVLEQFNTSQGELQKILHD
ADRIHNELSPLKLRCQANAACVDLMVWAVKDEQGAENLCIKLSEKLQSKTSSKVIIAHLP
LLICCLQGLGRLCERFPVVVHSVTPSLRDFLVIPSPVLVKLYKYHSQYHTVAGNDIKISV
TNEHSESTLNVMSGKKSQPSMYEQLRDIAIDNICRCLKAGLTVDPVIVEAFLASLSNRLY
ISQESDKDAHLIPDHTIRALGHIAVALRDTPKVMEPILQILQQKFCQPPSPLDVLIIDQL
GCLVITGNQYIYQEVWNLFQQISVKASSVVYSATKDYKDHGYRHCSLAVINALANIAANI
QDEHLVDELLMNLLELFVQLGLEGKRASERASEKGPALKASSSAGNLGVLIPVIAVLTRR
LPPIKEAKPRLQKLFRDFWLYSVLMGFAVEGSGLWPEEWYEGVCEIATKSPLLTFPSKEP
LRSVLQYNSAMKNDTVTPAELSELRSTIINLLDPPPEVSALINKLDFAMSTYLLSVYRLE
YMRVLRSTDPDRFQVMFCYFEDKAIQKDKSGMMQCVIAVADKVFDAFLNMMADKAKTKEN
EEELERHAQFLLVNFNHIHKRIRRVADKYLSGLVDKFPHLLWSGTVLKTMLDILQTLSLS
LSADIHKDQPYYDIPDAPYRITVPDTYEARESIVKDFAARCGMILQEAMKWAPTVTKSHL
QEYLNKHQNWVSGLSQHTGLAMATESILHFAGYNKQNTTLGATQLSERPACVKKDYSNFM
ASLNLRNRYAGEVYGMIRFSGTTGQMSDLNKMMVQDLHSALDRSHPQHYTQAMFKLTAML
ISSKDCDPQLLHHLCWGPLRMFNEHGMETALACWEWLLAGKDGVEVPFMREMAGAWHMTV
EQKFGLFSAEIKEADPLAASEASQPKPCPPEVTPHYIWIDFLVQRFEIAKYCSSDQVEIF
SSLLQRSMSLNIGGAKGSMNRHVAAIGPRFKLLTLGLSLLHADVVPNATIRNVLREKIYS
TAFDYFSCPPKFPTQGEKRLREDISIMIKFWTAMFSDKKYLTASQLVPPDNQDTRSNLDI
TVGSRQQATQGWINTYPLSSGMSTISKKSGMSKKTNRGSQLHKYYMKRRTLLLSLLATEI
ERLITWYNPLSAPELELDQAGENSVANWRSKYISLSEKQWKDNVNLAWSISPYLAVQLPA
RFKNTEAIGNEVTRLVRLDPGAVSDVPEAIKFLVTWHTIDADAPELSHVLCWAPTDPPTG
LSYFSSMYPPHPLTAQYGVKVLRSFPPDAILFYIPQIVQALRYDKMGYVREYILWAASKS
QLLAHQFIWNMKTNIYLDEEGHQKDPDIGDLLDQLVEEITGSLSGPAKDFYQREFDFFNK
ITNVSAIIKPYPKGDERKKACLSALSEVKVQPGCYLPSNPEAIVLDIDYKSGTPMQSAAK
APYLAKFKVKRCGVSELEKEGLRCRSDSEDECSTQEADGQKISWQAAIFKVGDDCRQDML
ALQIIDLFKNIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCTSRDQLGRQTDFGMYDYF
TRQYGDESTLAFQQARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDKKGHIIHIDFGFMF
ESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLAVRPYMDAVVSLVTL
MLDTGLPCFRGQTIKLLKHRFSPNMTEREAANFIMKVIQSCFLSNRSRTYDMIQYYQNDI
PY
NT seq 6309 nt   +upstreamnt  +downstreamnt
atggcggcggccccggcccggggaggcggaggcggaggcggaggcggcggcggctgctcc
ggctccggctccagcgcctcgcggggcttctatttcaacacggtcctgtcactggcccgc
tccctggcggtgcagagaccagcatccttggagaaggtccaaaagcttctttgcatgtgt
ccagtggatttccatgggatcttccagttagatgaaagacggagagatgcagtgattgca
ttgggcatttttctgattgaatctgatcttcagcacaaagattgtgtggttccttacctt
cttcgacttctcaaaggtcttccaaaagtgtattgggtagaagaaagcacagctcggaaa
ggcagaggtgccctcccggttgcagagagcttcagcttctgcttggtaactctgctgtct
gatgtggcctatagggatccttcacttagggatgagattttagaggtgcttttgcaggtt
ttgcatgtcctcttggggatgtgccaggccttggagattcaagacaaagaatacctttgc
aagtatgctatcccatgcctgataggaatctcgcgagcatttgggcgttacagcaacatg
gaagagtctctcctctcaaagctctttcccaaaatccctcctcattccctccgtgtcctg
gaagagcttgaaggtgttcgaaggcgttcctttaatgacttccgctccatcctccccagc
aatctgctgactgtctgtcaggagggtaccctgaagaggaaaaccagcagtgtgtccagc
atctctcaggtcagccctgaacgcggcatgccccctcccagttcccctggaggatctgcc
tttcactactttgaagcctcctgcttgcccgatgggactgccctagagcctgagtactac
ttttcaaccatcagctccagcttctcagtctctccccttttcaacggtgtcacatataag
gagtttaacattccattggaaatgcttcgggaactcttaaacctggtgaagaagatcgtt
gaggaggctgttctcaaatctttggatgccattgtagccagtgtgatggaggccaacccc
agtgctgatctctactacacttccttcagtgaccctctctacctgaccatgttcaagatg
ctgcgtgacactctgtactacatgaaggacctcccgacctcttttgtgaaggagatccat
gattttgtgctggagcagttcaacacgagccagggggagctccagaagattctacatgac
gcagaccggatccacaatgagctgagccccctcaaactgcgctgtcaggcgaatgctgcc
tgtgtggacctcatggtgtgggctgtgaaggacgagcagggtgcagaaaacctttgcatc
aagctatctgagaagctgcagtccaagacgtccagcaaagtcattattgctcacttgccc
ctgctgatctgctgtctgcagggtttgggccgcctgtgcgagaggttcccggtggtggtg
cactctgtgacaccgtccttgcgagacttcctggtcatcccgtccccagttctggtgaag
ctctacaagtaccacagtcagtaccacacagttgctggcaatgatataaaaatcagtgtg
accaatgagcattccgagtcaaccctgaacgtcatgtcgggtaagaagagccagccctcc
atgtacgagcagctccgagacatcgctattgacaacatctgcaggtgcctgaaggctgga
ttgacggtggacccagtgattgtggaggcgttcttggccagcctgtccaaccggctctac
atctctcaggagagcgacaaggacgctcacttgattcccgaccacacaatccgagccttg
ggacacattgcggtggccttgagggacaccccgaaggtcatggagcccattctgcagatc
ctacagcagaaattctgccagccaccctcccccctcgatgtgctgattattgaccagctg
ggctgcctggttatcaccggaaatcaatacatctatcaggaagtgtggaacctcttccag
cagatcagtgtgaaggccagctccgttgtatactcagccaccaaagattacaaggaccac
ggctataggcattgctccctggcagtgattaatgccctggccaacatcgcggccaacatc
caagacgagcacctggtggatgagctgctcatgaacctgttggagttgtttgtgcagctg
gggctggaggggaagcgagccagcgagagggcaagcgagaagggccctgccctaaaggct
tctagcagtgcagggaacttgggagtactcattcctgtaatagctgtgctcacccgacga
ctgccacccatcaaagaagctaagcctcggttacagaagctcttccgagacttctggctg
tattccgttctgatgggattcgctgtggagggctcaggactctggccagaagaatggtac
gagggggtctgtgaaatagccactaagtcccccttgctcacctttcccagcaaggagcca
ctgcggtccgtcctccagtataactcagccatgaagaatgacacggtcacccccgctgag
ctgagtgagctccgcagcactatcatcaacctgctggacccccctcccgaggtgtccgca
ctcatcaacaagctggacttcgccatgtccacctacctcctctctgtgtaccggctggag
tacatgagggtactgcgttcaacagatcctgatcgcttccaggtaatgttctgctacttt
gaggataaagctattcagaaagacaaatctgggatgatgcagtgtgtgattgcagtcgcg
gacaaagtattcgatgccttcctgaacatgatggcggataaagccaagaccaaggagaac
gaggaggagctggagcggcacgctcagttcctgttggtgaacttcaaccacatccacaag
aggataaggagggtggcagacaagtatctatctggtctggtggataagtttccccacttg
ctctggagcgggactgtgctgaagaccatgctggacatcctgcagaccctgtcactgtca
ctgagcgctgatattcacaaggatcagccttactatgacatccccgacgccccctaccgg
atcacggttcctgacacgtacgaagcccgtgagagcattgtgaaggacttcgctgcacgc
tgtgggatgatcctccaggaggccatgaagtgggcacctaccgtcaccaagtcccacctg
caggaatatctgaacaaacatcagaactgggtatcgggactgtcccagcacacggggctg
gccatggccactgagagcatccttcactttgctggctacaacaagcagaacacaactctt
ggggcaactcagctgagcgagcgcccggcctgtgtgaagaaagactactccaacttcatg
gcatccctgaatctgcgcaaccgctacgcgggcgaggtgtatggaatgattcggttctca
ggcaccacaggccagatgtctgacctgaacaaaatgatggtccaggatctacattcagct
ttagaccgcagtcatcctcagcactacacgcaggccatgttcaagctgaccgcaatgctc
attagcagtaaagattgtgacccgcagctccttcatcatctgtgctggggtcccctccgg
atgttcaatgagcatggcatggagacggccctggcctgctgggagtggctgctggctggc
aaggatggagtggaagtgccgttcatgcgggagatggcaggggcctggcacatgacggtg
gagcagaaatttggcctgttttctgctgagataaaggaagcagaccccctggctgcctcg
gaagcaagtcaacccaaaccctgtccccccgaagtgaccccccactacatctggatcgac
ttcctggtgcagcggtttgagatcgccaagtactgcagctctgaccaagtggagatcttc
tccagcctgctgcagcgctccatgtccctgaacatcggcggggccaaggggagcatgaac
cggcacgtggcggccatcgggccccgcttcaagctgctgaccctggggctgtccctcctg
catgccgatgtggttccaaatgcaaccatccgcaatgtgcttcgcgagaagatctactcc
actgcctttgactacttcagctgtcccccaaagttccctactcaaggagagaagcggctg
cgtgaagacataagcatcatgattaaattttggaccgccatgttctcagataagaagtac
ctgaccgccagccagcttgttcccccagataatcaggacacccggagcaacctggacata
actgtcggctctcggcaacaagccacccaaggctggatcaacacataccccctgtccagc
ggcatgtccaccatctccaagaaatcaggcatgtctaagaaaaccaaccggggctcccag
ctgcacaaatactacatgaagcgcaggacgctgctgctgtccctgctggccactgagatc
gagcgtctcatcacatggtacaacccgctgtcagccccggaactggaactagaccaggcc
ggagagaacagcgtggccaactggagatctaagtacatcagcctgagtgagaagcagtgg
aaggacaacgtgaacctcgcctggagcatctctccctacctagccgtgcagctgcctgcc
aggtttaagaacacagaagccattgggaacgaagtgacccgtctcgttcggttggacccg
ggagccgttagtgatgtgcctgaagcaatcaagttcctggtcacctggcacaccatcgac
gccgatgctccagagctcagccatgtgctgtgctgggcgcccacggacccacccacaggc
ctctcctacttctccagcatgtacccgccgcaccctctcacggcgcagtacggggtgaaa
gtcctgcggtccttccctccggacgccatcctcttctacatcccccagattgtgcaggcc
ctcaggtacgacaagatgggctatgtgcgggagtatattctgtgggcagcgtctaaatcc
cagcttctggcacaccagttcatctggaacatgaagactaacatttatctagatgaagag
ggccaccagaaagaccctgacatcggcgacctcctggatcagttggtagaggagatcaca
ggctccttgtccggcccagcgaaggacttttaccagcgggagtttgatttctttaacaag
atcaccaacgtgtcggctatcatcaagccctaccctaaaggcgacgagagaaagaaggct
tgtctgtcggccctgtctgaagtgaaggtgcagccgggctgctacctgcccagcaaccct
gaggccattgtgctggacatcgactacaagtctgggaccccgatgcagagtgctgcaaaa
gccccatatctggccaagttcaaggtgaagcgatgtggagttagtgaacttgaaaaagaa
ggtctgcggtgccgctcagactccgaggatgagtgcagcacgcaggaggccgacggccag
aagatctcctggcaggcagccatcttcaaggtgggagacgactgccggcaggacatgctg
gccctgcagatcatcgacctcttcaagaacatcttccagctggtcggcctggacctcttt
gtttttccctaccgcgtggtggccactgcccctgggtgcggggtgatcgagtgcatcccc
gactgcacctcccgggaccagctgggccgccagacagacttcggcatgtacgactacttc
acacgccagtacggggatgagtccactctggccttccagcaggcccgctacaacttcatc
cgaagcatggccgcctacagcctcctgctgttcctgctgcagatcaaggacagacacaac
ggcaacattatgctggacaagaagggtcatatcatccacatcgactttggcttcatgttt
gaaagctcgccgggcggcaatctcggctgggaacccgacatcaagctgacggatgagatg
gtgatgatcatggggggcaagatggaggccacacccttcaagtggttcatggagatgtgt
gtccgaggctacctggctgtgcggccctacatggacgcggtcgtctccctggtcactctc
atgttggacacgggcctgccctgttttcgcggccagacaatcaagctcttgaagcacagg
tttagccccaacatgactgagcgcgaggctgcaaatttcatcatgaaggtcatccagagc
tgcttcctcagcaacaggagccggacctacgacatgatccagtactatcagaatgacatc
ccctactga

KEGG   Homo sapiens (human): 5298
Entry
5298              CDS       T01001                                 

Symbol
PI4KB, NPIK, PI4K-BETA, PI4K92, PI4KBETA, PI4KIII, PI4KIIIBETA, PIK4CB
Name
(RefSeq) phosphatidylinositol 4-kinase beta
  KO
K19801  phosphatidylinositol 4-kinase B [EC:2.7.1.67]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5298 (PI4KB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    5298 (PI4KB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.67  1-phosphatidylinositol 4-kinase
     5298 (PI4KB)
SSDB
Motif
Pfam: PI3_PI4_kinase DUF4135
Other DBs
NCBI-GeneID: 5298
NCBI-ProteinID: NP_001317650
OMIM: 602758
HGNC: 8984
Ensembl: ENSG00000143393
Vega: OTTHUMG00000012348
Pharos: Q9UBF8(Tchem)
UniProt: Q9UBF8
LinkDB
Structure
PDB: 

Position
1q21.3
AA seq 816 aa
MGDTVVEPAPLKPTSEPTSGPPGNNGGSLLSVITEGVGELSVIDPEVAQKACQEVLEKVK
LLHGGVAVSSRGTPLELVNGDGVDSEIRCLDDPPAQIREEEDEMGAAVASGTAKGARRRR
QNNSAKQSWLLRLFESKLFDISMAISYLYNSKEPGVQAYIGNRLFCFRNEDVDFYLPQLL
NMYIHMDEDVGDAIKPYIVHRCRQSINFSLQCALLLGAYSSDMHISTQRHSRGTKLRKLI
LSDELKPAHRKRELPSLSPAPDTGLSPSKRTHQRSKSDATASISLSSNLKRTASNPKVEN
EDEELSSSTESIDNSFSSPVRLAPEREFIKSLMAIGKRLATLPTKEQKTQRLISELSLLN
HKLPARVWLPTAGFDHHVVRVPHTQAVVLNSKDKAPYLIYVEVLECENFDTTSVPARIPE
NRIRSTRSVENLPECGITHEQRAGSFSTVPNYDNDDEAWSVDDIGELQVELPEVHTNSCD
NISQFSVDSITSQESKEPVFIAAGDIRRRLSEQLAHTPTAFKRDPEDPSAVALKEPWQEK
VRRIREGSPYGHLPNWRLLSVIVKCGDDLRQELLAFQVLKQLQSIWEQERVPLWIKPYKI
LVISADSGMIEPVVNAVSIHQVKKQSQLSLLDYFLQEHGSYTTEAFLSAQRNFVQSCAGY
CLVCYLLQVKDRHNGNILLDAEGHIIHIDFGFILSSSPRNLGFETSAFKLTTEFVDVMGG
LDGDMFNYYKMLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSM
TEEQLQLLVEQMVDGSMRSITTKLYDGFQYLTNGIM
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgggagatacagtagtggagcctgcccccttgaagccaacttctgagcccacttctggc
ccaccagggaataatggggggtccctgctaagtgtcatcacggagggggtcggggaacta
tcagtgattgaccctgaggtggcccagaaggcctgccaggaggtgttggagaaagtcaag
cttttgcatggaggcgtggcagtctctagcagaggcaccccactggagttggtcaatggg
gatggtgtggacagtgagatccgttgcctagatgatccacctgcccagatcagggaggag
gaagatgagatgggggccgctgtggcctcaggcacagccaaaggagcaagaagacggcgg
cagaacaactcagctaaacagtcttggctgctgaggctgtttgagtcaaaactgtttgac
atctccatggccatttcatacctgtataactccaaggagcctggagtacaagcctacatt
ggcaaccggctcttctgctttcgcaacgaggacgtggacttctatctgccccagttgctt
aacatgtacatccacatggatgaggacgtgggtgatgccattaagccctacatagtccac
cgttgccgccagagcattaacttttccctccagtgtgccctgttgcttggggcctattct
tcagacatgcacatttccactcaacgacactcccgtgggaccaagctacggaagctgatc
ctctcagatgagctaaagccagctcacaggaagagggagctgccctccttgagcccggcc
cctgacacagggctgtctccctccaaaaggactcaccagcgctctaagtcagatgccact
gccagcataagtctcagcagcaacctgaaacgaacagccagcaaccctaaagtggagaat
gaggatgaggagctctcctccagcaccgagagtattgataattcattcagttcccctgtt
cgactggctcctgagagagaattcatcaagtccctgatggcgatcggcaagcggctggcc
acgctccccaccaaagagcagaaaacacagaggctgatctcagagctctccctgctcaac
cataagctccctgcccgagtctggctgcccactgctggctttgaccaccacgtggtccgt
gtaccccacacacaggctgttgtcctcaactccaaggacaaggctccctacctgatttat
gtggaagtccttgaatgtgaaaactttgacaccaccagtgtccctgcccggatccccgag
aaccgaattcggagtacgaggtccgtagaaaacttgcccgaatgtggtattacccatgag
cagcgagctggcagcttcagcactgtgcccaactatgacaacgatgatgaggcctggtcg
gtggatgacataggcgagctgcaagtggagctccccgaagtgcataccaacagctgtgac
aacatctcccagttctctgtggacagcatcaccagccaggagagcaaggagcctgtgttc
attgcagcaggggacatccgccggcgcctttcggaacagctggctcataccccgacagcc
ttcaaacgagacccagaagatccttctgcagttgctctcaaagagccctggcaggagaaa
gtacggcggatcagagagggctccccctacggccatctccccaattggcggctcctgtca
gtcattgtcaagtgtggggatgaccttcggcaagagcttctggcctttcaggtgttgaag
caactgcagtccatttgggaacaggagcgagtgcccctttggatcaagccatacaagatt
cttgtgatttcggctgatagtggcatgattgaaccagtggtcaatgctgtgtccatccat
caggtgaagaaacagtcacagctctccttgctcgattacttcctacaggagcacggcagt
tacaccactgaggcattcctcagtgcacagcgcaattttgtgcaaagttgtgctgggtac
tgcttggtctgctacctgctgcaagtcaaggacagacacaatgggaatatccttttggac
gcagaaggccacatcatccacatcgactttggcttcatcctctccagctcaccccgaaat
ctgggctttgagacgtcagcctttaagctgaccacagagtttgtggatgtgatgggcggc
ctggatggcgacatgttcaactactataagatgctgatgctgcaagggctgattgccgct
cggaaacacatggacaaggtggtgcagatcgtggagatcatgcagcaaggttctcagctt
ccttgcttccatggctccagcaccattcgaaacctcaaagagaggttccacatgagcatg
actgaggagcagctgcagctgctggtggagcagatggtggatggcagtatgcggtctatc
accaccaaactctatgacggcttccagtacctcaccaacggcatcatgtga

KEGG   Homo sapiens (human): 55300
Entry
55300             CDS       T01001                                 

Symbol
PI4K2B, PI4KIIB, PIK42B
Name
(RefSeq) phosphatidylinositol 4-kinase type 2 beta
  KO
K13711  phosphatidylinositol 4-kinase type 2 [EC:2.7.1.67]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    55300 (PI4K2B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    55300 (PI4K2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55300 (PI4K2B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.67  1-phosphatidylinositol 4-kinase
     55300 (PI4K2B)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    55300 (PI4K2B)
SSDB
Motif
Pfam: PI3_PI4_kinase
Other DBs
NCBI-GeneID: 55300
NCBI-ProteinID: NP_060793
OMIM: 612101
HGNC: 18215
Ensembl: ENSG00000038210
Vega: OTTHUMG00000128564 OTTHUMG00000189521
Pharos: Q8TCG2(Tbio)
UniProt: Q8TCG2
LinkDB
Position
4p15.2
AA seq 481 aa
MEDPSEPDRLASADGGSPEEEEDGEREPLLPRIAWAHPRRGAPGSAVRLLDAAGEEGEAG
DEELPLPPGDVGVSRSSSAELDRSRPAVSVTIGTSEMNAFLDDPEFADIMLRAEQAIEVG
IFPERISQGSSGSYFVKDPKRKIIGVFKPKSEEPYGQLNPKWTKYVHKVCCPCCFGRGCL
IPNQGYLSEAGAYLVDNKLHLSIVPKTKVVWLVSETFNYNAIDRAKSRGKKYALEKVPKV
GRKFHRIGLPPKIGSFQLFVEGYKEAEYWLRKFEADPLPENIRKQFQSQFERLVILDYII
RNTDRGNDNWLVRYEKQKCEKEIDHKESKWIDDEEFLIKIAAIDNGLAFPFKHPDEWRAY
PFHWAWLPQAKVPFSEEIRNLILPYISDMNFVQDLCEDLYELFKTDKGFDKATFESQMSV
MRGQILNLTQALRDGKSPFQLVQIPCVIVERSQGGSQGRIVHLSNSFTQTVNCRKPFFSS
W
NT seq 1446 nt   +upstreamnt  +downstreamnt
atggaggatccctccgagcccgaccggttggcgtccgcggacggcgggagcccggaggag
gaggaggatggggagcgggagccgctgctaccgcggatcgcctgggcccacccgcggaga
ggcgccccaggcagcgccgtgaggctgctggacgctgccggggaggagggcgaggccggc
gacgaggagctgcccctcccgcccggggacgtgggggtctcccggagttcgtccgccgag
ctggaccggagccgccccgcggtttcagtaactattggtacttcagagatgaatgcattc
ttggatgacccagaatttgccgatattatgctgagagcagagcaagcaatagaagttgga
atttttccagaaagaatctctcaaggttcaagtggaagttactttgtgaaggatcctaag
aggaaaattattggtgtgtttaaacccaaatcagaagagccttatggtcaactcaatcca
aaatggaccaaatatgtccataaggtctgctgcccttgctgctttggccgaggctgcctg
attcctaatcaggggtacctttccgaagcgggtgcctatcttgtggacaacaagcttcat
ctgagcattgtacctaaaacaaaggtggtttggcttgtcagtgagacatttaactataat
gcgattgaccgtgcaaaatcaagaggcaaaaagtatgctttagaaaaagtgccaaaagtg
ggtagaaagtttcataggataggactccctcctaagattggttcctttcagttatttgtt
gaaggttacaaggaggctgaatattggcttaggaaatttgaagctgaccctttgcctgag
aatattagaaaacaatttcagtcacaatttgaaagattagttattttggattacatcatc
agaaatacagacaggggcaatgataattggttagtcagatacgaaaagcagaaatgtgaa
aaggaaattgaccataaggaatcaaaatggattgatgatgaagaattccttattaaaata
gctgcaattgataatggtctagcatttccttttaaacatcctgatgaatggagagcatat
ccatttcactgggcttggcttcctcaagcaaaagttcccttttctgaagaaataagaaat
ttgattctaccatatatttctgacatgaactttgtgcaagatttatgtgaagatctctat
gaactttttaagactgacaaaggatttgacaaagccacttttgaaagtcagatgtctgtg
atgaggggtcagatcttaaaccttactcaggcattgagagacgggaagagtcctttccag
ctagtacagataccttgtgtgattgtggaacgcagtcaaggtggaagtcagggtcggatt
gtccacctgagcaattcctttacccagactgtcaattgcaggaagccatttttttcctcc
tggtag

KEGG   Homo sapiens (human): 55361
Entry
55361             CDS       T01001                                 

Symbol
PI4K2A, PI4KII, PIK42A
Name
(RefSeq) phosphatidylinositol 4-kinase type 2 alpha
  KO
K13711  phosphatidylinositol 4-kinase type 2 [EC:2.7.1.67]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
Module
hsa_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    55361 (PI4K2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    55361 (PI4K2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55361 (PI4K2A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.67  1-phosphatidylinositol 4-kinase
     55361 (PI4K2A)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    55361 (PI4K2A)
SSDB
Motif
Pfam: PI3_PI4_kinase Ribosomal_S15
Other DBs
NCBI-GeneID: 55361
NCBI-ProteinID: NP_060895
OMIM: 609763
HGNC: 30031
Ensembl: ENSG00000155252
Vega: OTTHUMG00000018863
Pharos: Q9BTU6(Tbio)
UniProt: Q9BTU6
LinkDB
Structure
PDB: 
4HNE 4HND

Position
10q24.2
AA seq 479 aa
MDETSPLVSPERAQPPDYTFPSGSGAHFPQVPGGAVRVAAAAGSGPSPPGSPGHDRERQP
LLDRARGAAAQGQTQTVAAQAQALAAQAAAAAHAAQAHRERNEFPEDPEFEAVVRQAELA
IERCIFPERIYQGSSGSYFVKDPQGRIIAVFKPKNEEPYGHLNPKWTKWLQKLCCPCCFG
RDCLVLNQGYLSEAGASLVDQKLELNIVPRTKVVYLASETFNYSAIDRVKSRGKRLALEK
VPKVGQRFNRIGLPPKVGSFQLFVEGYKDADYWLRRFEAEPLPENTNRQLLLQFERLVVL
DYIIRNTDRGNDNWLIKYDCPMDSSSSRDTDWVVVKEPVIKVAAIDNGLAFPLKHPDSWR
AYPFYWAWLPQAKVPFSQEIKDLILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQI
AVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFSWW
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggacgagacgagcccactagtgtcccccgagcgggcccaacccccggactacaccttc
ccgtcgggctcgggcgctcactttccgcaggtgcccgggggcgcggtccgagtggcggcg
gcggccggctcgggcccctctccgccgggctcgccgggccacgaccgcgagcggcagcca
ctgttggatcgggcccggggcgcggcggcccagggccagacccaaaccgtggcggcgcag
gcccaggctctggccgctcaggccgcggcggcagcccacgccgctcaggcccaccgcgag
cggaacgagttcccggaggatcctgagttcgaggcggtggtgcggcaggccgagctggcc
atcgagcgctgcatctttcccgagcgcatctaccagggctccagcggaagctacttcgtc
aaggaccctcaggggaggatcattgctgtcttcaaacccaagaatgaagagccctatggg
catcttaatcctaagtggaccaagtggctgcagaagctgtgctgtccttgctgctttggc
cgtgactgccttgtccttaaccagggctatctctcagaagcaggggccagcctggtggac
caaaaactggaactcaacattgttccccgtacaaaggtagtatacctggccagtgagacc
ttcaactatagtgccattgaccgagtgaagtccaggggcaagcggcttgcactagagaaa
gtgccaaaagttggacagcggtttaaccgcatcgggctaccaccaaaggttggttcattc
cagctctttgttgaaggctacaaagatgcagactattggctgcggcgttttgaagcagaa
cctcttcctgagaacactaaccggcaactactgctccagtttgagcggttggtggtgctg
gattacatcatccgcaacactgatcgaggcaatgacaactggctgattaaatatgactgt
ccaatggatagttctagctctcgggacacagactgggtggtggtgaaggagcctgttatc
aaggtggctgccatagacaatgggctggccttcccactgaagcatcctgactcctggagg
gcatatcctttttactgggcctggttgccccaggcgaaagtcccattttctcaggagatc
aaagatctgatccttccaaagatatcggaccctaacttcgtcaaggacttggaagaggac
ctatatgaactcttcaagaaagatcctggtttcgacaggggccagttccataagcagatt
gctgtcatgcggggccagatcttaaatctgacccaggccttgaaagacaacaagagtccc
ctgcacctcgtccagatgccacctgtgattgtcgagacggcccgttcccaccagcggtct
tctagcgagtcctacacacagagctttcagagccggaagcccttcttttcatggtggtag

DBGET integrated database retrieval system