KEGG   Homo sapiens (human): 54457
Entry
54457             CDS       T01001                                 

Gene name
TAF7L, CT40, TAF2Q
Definition
(RefSeq) TATA-box binding protein associated factor 7 like
  KO
K03132  transcription initiation factor TFIID subunit 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    54457 (TAF7L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    54457 (TAF7L)
   03036 Chromosome and associated proteins [BR:hsa03036]
    54457 (TAF7L)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     54457 (TAF7L)
   Coactivators
    SAGA/TFTC/STAGA complex
     54457 (TAF7L)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TFTC complex
     54457 (TAF7L)
SSDB
Motif
Pfam: TAFII55_N
Other DBs
NCBI-GeneID: 54457
NCBI-ProteinID: NP_079161
OMIM: 300314
HGNC: 11548
Ensembl: ENSG00000102387
Vega: OTTHUMG00000022021
Pharos: Q5H9L4(Tbio)
UniProt: Q5H9L4
LinkDB
Position
Xq22.1
AA seq 462 aa
MECPEGQLPISSENDSTPTVSTSEVTSQQEPQILVDRGSETTYESSADIAGDEGTQIPAD
EDTQTDADSSAQAAAQAPENFQEGKDMSESQDEVPDEVENQFILRLPLEHACTVRNLARS
QSVKMKDKLKIDLLPDGRHAVVEVEDVPLAAKLVDLPCVIESLRTLDKKTFYKTADISQM
LVCTADGDIHLSPEEPAASTDPNIVRKKERGREEKCVWKHGITPPLKNVRKKRFRKTQKK
VPDVKEMEKSSFTEYIESPDVENEVKRLLRSDAEAVSTRWEVIAEDGTKEIESQGSIPGF
LISSGMSSHKQGHTSSEYDMLREMFSDSRSNNDDDEDEDDEDEDEDEDEDEDEDKEEEEE
DCSEEYLERQLQAEFIESGQYRANEGTSSIVMEIQKQIEKKEKKLHKIQNKAQRQKDLIM
KVENLTLKNHFQSVLEQLELQEKQKNEKLISLQEQLQRFLKK
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggagtgccccgagggacagctccccatttcttcagaaaatgattcaacaccaacagtt
tcaacatcggaagtaactagccaacaagaaccccaaattcttgtcgaccgtgggtctgaa
accacctatgaaagcagcgccgacattgctggcgacgaaggcacccagattcctgccgac
gaggacactcaaacggatgcggacagcagcgcccaggctgctgcccaggccccagaaaac
ttccaggaagggaaagacatgagtgaaagccaggatgaagttcctgatgaagttgagaac
cagtttatattgcgtctgcctctggaacatgcttgtactgtcaggaacctagcacgttct
caaagtgtcaagatgaaggataaactaaaaattgacttattgcctgatgggcgccatgca
gttgttgaagtagaagatgtcccactagctgctaagctggttgacttgccttgtgttatt
gaaagcctgagaacgcttgataaaaaaaccttttataaaacagcagacatttctcagatg
cttgtgtgcactgctgatggtgatatccacctttctccagaagaaccagctgcctctact
gatcctaatatagtcaggaaaaaagaaagggggagagaagaaaaatgtgtctggaagcat
ggcattacgccaccacttaagaatgtcagaaagaaaaggttccggaaaacacaaaaaaag
gtccctgatgtcaaagaaatggaaaaaagcagctttactgagtacattgaatctccagac
gtggaaaatgaagtaaagagactgctgcgttcggatgctgaagccgtaagtacccgttgg
gaagtcattgctgaagatggaaccaaggaaatagaaagtcaaggctccatcccaggattt
ttgatatcctcgggaatgagcagccacaagcagggtcatacctcgtcagaatatgatatg
cttcgggagatgttcagtgattctagaagtaacaatgatgatgatgaggatgaggatgat
gaagatgaggatgaggatgaggatgaggatgaagatgaagacaaagaagaggaggaggaa
gattgttctgaagagtatctggaaaggcagctgcaggccgagtttattgaatctggccag
tatagggcaaatgaaggtaccagttcaatagtcatggaaattcagaagcagattgagaaa
aaggagaaaaagctccataagattcagaataaagcacaaagacagaaggatctcatcatg
aaagtggaaaacctgacactcaagaatcattttcagtctgtgctggagcagcttgagtta
caggaaaaacaaaaaaatgagaagctcatttccctacaggaacagttgcagcgttttctg
aagaagtga

KEGG   Homo sapiens (human): 6879
Entry
6879              CDS       T01001                                 

Gene name
TAF7, TAF2F, TAFII55
Definition
(RefSeq) TATA-box binding protein associated factor 7
  KO
K03132  transcription initiation factor TFIID subunit 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    6879 (TAF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    6879 (TAF7)
   03036 Chromosome and associated proteins [BR:hsa03036]
    6879 (TAF7)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     6879 (TAF7)
   Coactivators
    SAGA/TFTC/STAGA complex
     6879 (TAF7)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    TFTC complex
     6879 (TAF7)
SSDB
Motif
Pfam: TAFII55_N
Other DBs
NCBI-GeneID: 6879
NCBI-ProteinID: NP_005633
OMIM: 600573
HGNC: 11541
Ensembl: ENSG00000178913
Vega: OTTHUMG00000129628
Pharos: Q15545(Tbio)
UniProt: Q15545
LinkDB
Structure
PDB: 
4RGW 6MZM 5FUR 6MZL

Position
5q31.3
AA seq 349 aa
MSKSKDDAPHELESQFILRLPPEYASTVRRAVQSGHVNLKDRLTIELHPDGRHGIVRVDR
VPLASKLVDLPCVMESLKTIDKKTFYKTADICQMLVSTVDGDLYPPVEEPVASTDPKASK
KKDKDKEKKFIWNHGITLPLKNVRKRRFRKTAKKKYIESPDVEKEVKRLLSTDAEAVSTR
WEIIAEDETKEAENQGLDISSPGMSGHRQGHDSLEHDELREIFNDLSSSSEDEDETQHQD
EEDINIIDTEEDLERQLQDKLNESDEQHQENEGTNQLVMGIQKQIDNMKGKLQETQDRAK
RQEDLIMKVENLALKNRFQAVLDELKQKEDREKEQLSSLQEELESLLEK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgagtaaaagcaaagatgatgctcctcacgaactggagagccagtttatcttacgtctg
cctccagaatatgcctctactgtgagaagggcagtacagtctggtcatgtcaacctcaag
gacagactgacaattgagttacatcctgatgggcgtcatggaatcgtcagagtggaccgt
gttccattggcctcaaaattagtagacctgccctgtgttatggaaagcttgaaaaccatt
gataaaaaaactttttacaagacagctgatatctgtcagatgcttgtatccacagttgat
ggtgatctctatcctcctgtggaggagccagttgctagcactgatcctaaagcaagcaag
aaaaaggataaggacaaagagaaaaagtttatctggaaccacggaattactctgcctcta
aagaatgtcaggaagagaaggttccggaagacagcaaagaagaaatatattgaatctcca
gatgttgaaaaagaagtgaaacgattgctgagtacagatgctgaagctgttagtactcgg
tgggaaataattgccgaagatgaaacaaaggaggcagaaaatcaaggcctggatatctct
tctccaggaatgtctggtcacaggcagggccatgactcattagaacatgatgagcttcgg
gagatattcaatgacctcagcagcagcagtgaggatgaagatgagacccagcatcaagat
gaagaagatataaacatcattgacacggaggaagatctggagagacagctacaggacaag
ctaaatgaatcagatgaacagcaccaggaaaatgaaggaaccaatcagctggttatggga
attcagaagcagattgacaacatgaaaggcaagctccaagagacccaggacagggcaaaa
cgacaagaggatctcatcatgaaagtggaaaatctggctctcaagaacagatttcaggct
gtactggatgagctcaaacaaaaggaagaccgagaaaaggagcaactcagctctttgcaa
gaggagctagaatcactcctagagaagtaa

DBGET integrated database retrieval system