KEGG   Homo sapiens (human): 55183
Entry
55183             CDS       T01001                                 
Symbol
RIF1
Name
(RefSeq) replication timing regulatory factor 1
  KO
K11138  telomere-associated protein RIF1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    55183 (RIF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    55183 (RIF1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other termination factors
    55183 (RIF1)
SSDB
Motif
Pfam: Rif1_N NICE-1
Other DBs
NCBI-GeneID: 55183
NCBI-ProteinID: NP_060621
OMIM: 608952
HGNC: 23207
Ensembl: ENSG00000080345
Vega: OTTHUMG00000131886
Pharos: Q5UIP0(Tbio)
UniProt: Q5UIP0
LinkDB
Position
2:151409902..151534435
AA seq 2472 aa
MTARGQSPLAPLLETLEDPSASHGGQTDAYLTLTSRMTGEEGKEVITEIEKKLPRLYKVL
KTHISSQNSELSSAALQALGFCLYNPKITSELSEANALELLSKLNDTIKNSDKNVRTRAL
WVISKQTFPSEVVGKMVSSIIDSLEILFNKGETHSAVVDFEALNVIVRLIEQAPIQMGEE
AVRWAKLVIPLVVHSAQKVHLRGATALEMGMPLLLQKQQEIASITEQLMTTKLISELQKL
FMSKNETYVLKLWPLFVKLLGRTLHRSGSFINSLLQLEELGFRSGAPMIKKIAFIAWKSL
IDNFALNPDILCSAKRLKLLMQPLSSIHVRTETLALTKLEVWWYLLMRLGPHLPANFEQV
CVPLIQSTISIDSNASPQGNSCHVATSPGLNPMTPVHKGASSPYGAPGTPRMNLSSNLGG
MATIPSIQLLGLEMLLHFLLGPEALSFAKQNKLVLSLEPLEHPLISSPSFFSKHANTLIT
AVHDSFVAVGKDAPDVVVSAIWKELISLVKSVTESGNKKEKPGSEVLTLLLKSLESIVKS
EVFPVSKTLVLMEITIKGLPQKVLGSPAYQVANMDILNGTPALFLIQLIFNNFLECGVSD
ERFFLSLESLVGCVLSGPTSPLAFSDSVLNVINQNAKQLENKEHLWKMWSVIVTPLTELI
NQTNEVNQGDALEHNFSAIYGALTLPVNHIFSEQRFPVATMKTLLRTWSELYRAFARCAA
LVATAEENLCCEELSSKIMSSLEDEGFSNLLFVDRIIYIITVMVDCIDFSPYNIKYQPKV
KSPQRPSDWSKKKNEPLGKLTSLFKLIVKVIYSFHTLSFKEAHSDTLFTIGNSITGIISS
VLGHISLPSMIRKIFATLTRPLALFYENSKLDEVPKVYSCLNNKLEKLLGEIIACLQFSY
TGTYDSELLEQLSPLLCIIFLHKNKQIRKQSAQFWNATFAKVMMLVYPEELKPVLTQAKQ
KFLLLLPGLETVEMMEESSGPYSDGTENSQLNVKISGMERKSNGKRDSFLAQTKNKKENM
KPAAKLKLESSSLKVKGEILLEEEKSTDFVFIPPEGKDAKERILTDHQKEVLKTKRCDIP
AMYNNLDVSQDTLFTQYSQEEPMEIPTLTRKPKEDSKMMITEEQMDSDIVIPQDVTEDCG
MAEHLEKSSLSNNECGSLDKTSPEMSNSNNDERKKALISSRKTSTECASSTENSFVVSSS
SVSNTTVAGTPPYPTSRRQTFITLEKFDGSENRPFSPSPLNNISSTVTVKNNQETMIKTD
FLPKAKQREGTFSKSDSEKIVNGTKRSSRRAGKAEQTGNKRSKPLMRSEPEKNTEESVEG
IVVLENNPPGLLNQTECVSDNQVHLSESTMEHDNTKLKAATVENAVLLETNTVEEKNVEI
NLESKENTPPVVISADQMVNEDSQVQITPNQKTLRRSSRRRSEVVESTTESQDKENSHQK
KERRKEEEKPLQKSPLHIKDDVLPKQKLIAEQTLQENLIEKGSNLHEKTLGETSANAETE
QNKKKADPENIKSEGDGTQDIVDKSSEKLVRGRTRYQTRRASQGLLSSIENSESDSSEAK
EEGSRKKRSGKWKNKSNESVDIQDQEEKVVKQECIKAENQSHDYKATSEEDVSIKSPICE
KQDESNTVICQDSTVTSDLLQVPDDLPNVCEEKNETSKYAEYSFTSLPVPESNLRTRNAI
KRLHKRDSFDNCSLGESSKIGISDISSLSEKTFQTLECQHKRSRRVRRSKGCDCCGEKSQ
PQEKSLIGLKNTENNDVEISETKKADVQAPVSPSETSQANPYSEGQFLDEHHSVNFHLGL
KEDNDTINDSLIVSETKSKENTMQESLPSGIVNFREEICDMDSSEAMSLESQESPNENFK
TVGPCLGDSKNVSQESLETKEEKPEETPKMELSLENVTVEGNACKVTESNLEKAKTMELN
VGNEASFHGQERTKTGISEEAAIEENKRNDDSEADTAKLNAKEVATEEFNSDISLSDNTT
PVKLNAQTEISEQTAAGELDGGNDVSDLHSSEETNTKMKNNEEMMIGEAMAETGHDGETE
NEGITTKTSKPDEAETNMLTAEMDNFVCDTVEMSTEEGIIDANKTETNTEYSKSEEKLDN
NQMVMESDILQEDHHTSQKVEEPSQCLASGTAISELIIEDNNASPQKLRELDPSLVSAND
SPSGMQTRCVWSPLASPSTSILKRGLKRSQEDEISSPVNKVRRVSFADPIYQAGLADDID
RRCSIVRSHSSNSSPIGKSVKTSPTTQSKHNTTSAKGFLSPGSRSPKFKSSKKCLISEMA
KESIPCPTESVYPPLVNCVAPVDIILPQITSNMWARGLGQLIRAKNIKTIGDLSTLTASE
IKTLPIRSPKVSNVKKALRIYHEQQVKTRGLEEIPVFDISEKTVNGIENKSLSPDEERLV
SDIIDPVALEIPLSKNLLAQISALALQLDSEDLHNYSGSQLFEMHEKLSCMANSVIKNLQ
SRWRSPSHENSI
NT seq 7419 nt   +upstreamnt  +downstreamnt
atgacggccaggggtcagagccccctcgcgccgctgttggagactttggaagacccttct
gcctcccatggagggcagactgacgcttacctgactctgaccagtcgtatgactggagaa
gaaggaaaagaagtaattacagaaattgagaaaaaacttcctcggctgtacaaagtttta
aagactcacatttccagtcaaaactcggagctgagtagtgctgctctacaagccctgggg
ttttgcttatataatcccaaaattacctcagaattatcagaggcaaatgctctagaattg
ctttcaaaattgaatgataccattaagaattcagacaaaaatgtacgtactagagcactt
tgggtgatatctaagcagacatttccctctgaagtggttggcaaaatggtatccagtata
attgattcattagaaatactgtttaacaaaggagagacgcattctgctgttgttgatttt
gaagcattaaatgttatcgtaaggctaattgaacaagccccaattcaaatgggagaagag
gcagtgaggtgggcaaaactggtcatacctttagtggttcattcagcacaaaaggtacat
ttgcggggagcaactgctctggagatgggaatgccattattgcttcagaaacagcaagaa
atagcatctattacggagcagcttatgactactaaattaatctcagaacttcagaagcta
tttatgagtaaaaatgagacttacgtgttaaaattatggcctttgtttgtcaaactactt
ggaaggaccttgcatcgaagtgggagtttcatcaattctctcttgcaactagaagaactt
ggatttcgtagtggagcacccatgattaaaaagatagcttttattgcttggaagagttta
atagataattttgctttaaatccagatatactatgtagtgcaaaaagactcaagttgtta
atgcagcctttgagttccatccatgtgagaacagaaactctagcattaacaaaactagaa
gtctggtggtatttactgatgagacttggacctcatcttcctgctaattttgaacaggtt
tgtgtgcctctgattcaaagtacaataagcattgattctaatgcctcacctcagggcaat
tcgtgtcatgtagctacatctccaggtttaaatcctatgactcctgtacacaaaggtgct
tcctccccgtacggagccccgggaactccccgaatgaacctgagttcgaatttaggtgga
atggccacaatcccatccattcaacttttgggacttgaaatgttgcttcatttcttgttg
ggtccagaagccttgagttttgctaagcaaaataaacttgtgctgagcttagagccattg
gaacatccgttaatcagcagcccttcctttttttccaaacatgcaaatacacttatcact
gctgttcatgatagctttgttgcagttggaaaagatgcccccgatgtggttgtcagtgct
atctggaaggagctaattagcttggtgaagtcagttactgaatcaggtaacaaaaaagag
aaaccaggttctgaagttttgactctcttattaaagtctttggaaagcatagtaaagtct
gaagtatttcctgtatcaaaaacgctggtcctcatggaaattacaattaaaggacttcct
cagaaagtattaggttcaccagcatatcaggttgctaatatggatattcttaatggaact
ccagctttgttcttaattcaattaattttcaacaatttcttggaatgtggtgtatcagat
gaaaggttctttctcagtttggaatcacttgtaggctgtgttctttctggtccaacttca
ccactagctttcagtgactcagttttaaatgttattaatcaaaatgcaaagcagttggaa
aataaggagcatctctggaaaatgtggagtgttatagtcaccccattaactgaattgatt
aatcagaccaatgaagtaaatcaaggtgatgccttagaacataattttagtgccatctat
ggtgcattgactttaccagtaaaccacattttttcagaacagagatttccagtggccacc
atgaagactttgcttagaacttggtcagaattatatagagcatttgctcgttgtgctgct
ttggtggcaacagcagaagagaacttgtgctgtgaggaactttcttccaagataatgtcc
agtttggaagatgaaggcttttctaatttgttgttcgtggatagaattatttatattatt
actgtaatggttgattgcattgacttctcaccatataatattaaatatcagcccaaagtt
aaatcaccacagagaccttcagattggtccaaaaagaagaatgagcccctagggaaattg
acttctttatttaaacttattgtgaaagtgatctattctttccacacactgagcttcaag
gaagcacattctgataccctcttcactattggcaactcaatcaccggcattatttccagt
gtacttgggcatatttctttgccttctatgatccgaaaaatatttgcaactttaacaaga
cctctggcattattttatgaaaactcaaagcttgatgaagttcctaaagtatatagttgt
ctgaacaacaagttagaaaagctactgggagaaattattgcttgtctgcaattcagctac
accggaacttatgatagtgaacttcttgaacaactctccccactattatgcataatattt
ctgcacaagaataaacagattcgaaaacagagtgctcagttctggaatgccacttttgcc
aaagtgatgatgttggtttatcctgaagagttaaaaccagtactaacacaagccaaacaa
aaatttctgctcctgttgcctggtttggaaactgttgaaatgatggaggaatccagtgga
ccatattctgatggaacagaaaattcacaactaaatgtgaagataagtggcatggagaga
aaatcaaatggaaaaagagattcatttttggcacaaacaaagaataaaaaagaaaatatg
aaaccagcagccaaactgaaacttgaatcttcgtctttaaaagtaaagggtgaaattctt
ttggaagaggaaaagtctactgactttgtgtttatacctccagaaggaaaagatgcaaag
gaaagaatattaactgatcatcaaaaagaagttctcaaaacaaagcggtgtgatattcct
gccatgtataataatctggatgtttcccaagataccttatttactcagtatagtcaggaa
gagcctatggaaattcctactttaaccagaaaaccaaaggaggattctaagatgatgatt
acggaggagcaaatggacagtgacattgtcattcctcaagatgtcacggaagactgtggt
atggctgaacatcttgaaaagtcctccctttcgaataatgagtgtggttctcttgacaaa
accagtccagaaatgtcaaacagtaataatgatgaaagaaaaaaagctttaatttcatca
aggaaaacatcaactgaatgtgcatctagtacagaaaattctttcgttgtcagcagtagt
tcagtttctaataccactgttgctggaactcccccataccctacaagtcggaggcaaacc
tttattactttggagaagtttgatggttcagaaaatagaccttttagtccatcccccttg
aataatatttcatcaactgttacagtgaaaaataaccaggaaaccatgattaaaacagat
tttctaccaaaagcaaagcaaagagaagggactttttcaaaatctgattctgaaaaaata
gtgaatggaactaagagatcaagccggagagctggtaaagctgaacaaacagggaataaa
aggtctaagcccttaatgagatctgagccggagaaaaatactgaggaatctgttgaaggc
attgtagtcttagaaaataacccacctggtttgcttaatcaaacagaatgtgtgtcagat
aatcaggttcatctttctgaatctacaatggagcatgacaatacaaagcttaaagcagca
acagtggaaaatgctgtattattggaaactaatactgtagaggagaaaaatgtagaaatt
aatttggaatccaaagagaatacacccccagtagtaatatcagcagatcaaatggtaaat
gaggatagtcaggttcagataactccaaatcagaaaacccttagacggtcttcaaggcga
cgttcagaagtagtagagtctaccactgaaagccaagataaggaaaatagtcatcaaaaa
aaggaacgacgtaaggaagaagaaaaacctcttcagaagagtccattgcatataaaagat
gatgtgttacctaaacaaaaactgattgctgaacaaactctacaggagaatttaattgag
aaaggaagtaatttacatgagaagactcttggggaaactagtgctaatgcagaaactgaa
caaaataaaaaaaaggcagaccctgagaacattaagtctgagggggatggtacccaggac
attgtagataagtcctctgagaaactagtcagaggccgaacacggtatcaaactagaaga
gcatctcagggtttgctttccagcattgaaaactcagaatctgatagttcggaggcaaaa
gaagaaggttctaggaagaagagatctggaaaatggaaaaacaaaagcaatgaaagtgtt
gacattcaagatcaagaagagaaagtggtgaaacaggaatgtataaaagctgaaaatcag
tcacatgattataaagcaacttctgaagaagatgtaagcataaaatctccgatttgcgaa
aaacaagatgaaagtaatactgtaatatgtcaggattctacagtaacttcagatttgttg
caagttcctgatgatttaccaaatgtgtgtgaggaaaaaaatgaaactagcaaatatgca
gaatattcctttacaagtctacctgtgccagaatcaaatctaaggactagaaatgccatt
aagagattacataagcgagactcttttgataattgtagtttgggagaatcctcaaaaata
gggatatcagatatttcttcgctttcagaaaaaacttttcaaacacttgaatgccaacac
aagagaagtaggagggtgaggagatctaaaggttgtgattgctgtggggaaaaatcacaa
cctcaggaaaagtcactcattgggttaaagaatacagaaaataatgacgtagagattagt
gaaacaaaaaaggcagatgtgcaagcacctgtaagcccatcagaaacttctcaagctaat
ccatattctgaaggacaatttttagatgaacatcatagtgtgaattttcatttgggtctc
aaagaggataatgatactattaatgattcattaattgtttctgaaaccaaatcaaaagaa
aacactatgcaagaatctcttccttctggaatagtaaactttagagaggaaatttgtgat
atggattctagtgaagcaatgtctcttgaaagccaggagtcacctaatgaaaattttaaa
actgttggcccgtgtttaggagactcgaaaaatgtttcacaggaatctttggagacaaaa
gaagaaaaaccagaagaaaccccaaaaatggaactgagtctagagaatgttactgttgaa
ggaaatgcatgtaaagtaacagaatccaatctagagaaagcaaaaactatggaattgaat
gtaggaaatgaagctagctttcatggacaagagagaaccaaaactggtatttctgaagaa
gcagcaatagaagaaaataaaagaaatgatgactctgaagcagacacagctaaactgaat
gccaaagaagtagcaactgaggaatttaattcagatattagtctttctgataatactaca
cctgtaaaattgaatgctcaaactgagatttctgaacaaacagcagctggggaactagat
ggaggaaatgatgtatctgatctacactcatctgaagaaacgaataccaaaatgaaaaat
aatgaagaaatgatgatcggcgaggcaatggctgaaactggccatgatggtgaaacagag
aatgagggcataactaccaaaacctcaaagcctgatgaagctgaaacaaacatgttgact
gcagaaatggacaactttgtttgtgacacagttgaaatgagcactgaagaaggaatcatt
gacgctaataaaactgaaacaaatactgagtatagtaaatctgaagaaaaattagataac
aatcaaatggtaatggaaagtgatattttacaggaagatcaccatacttcacagaaagtg
gaggaaccatcacagtgtctggcatctggaacagctatctctgagctaataatagaagac
aataatgcatctcctcaaaaactaagggaacttgatccttcacttgtgtcagcaaatgac
agtcctagtggcatgcagacacgctgtgtctggtctcctttggcttctccgtctacgagc
attttaaagagaggactaaaaagatcccaagaagatgaaatctcatcacctgttaataag
gttcgccgtgtctcctttgcagatccaatataccaagcaggattggcagatgacattgat
agacggtgctctattgttaggtcccattcttccaatagttctcccataggaaaaagtgtt
aaaacttctcctactacacaatctaagcataataccacttcagccaaaggatttctgtcc
ccaggatcacgtagccctaaatttaagagctcaaagaagtgtttaatttcagaaatggcc
aaagaatccataccatgcccaacagaaagtgtttacccaccattggtgaactgtgtggca
ccagttgacatcattttacctcagattacatcaaacatgtgggcaagaggcctgggacaa
ctcattagagctaagaatataaaaactattggtgatttgagtactcttacagcatctgaa
ataaaaactcttcctatccgttctccaaaagtgtccaatgtaaaaaaggctctcagaata
tatcatgagcagcaggtgaagactcgtggactagaagagattccagtttttgatatttct
gaaaaaacagtaaatggaatagaaaataaatctttgtcacctgatgaagaaagacttgtc
tcagatataattgatcctgttgctttagaaattccattatccaaaaaccttctggcacag
attagtgctcttgctcttcagctggattcagaagatcttcataattattcaggaagccaa
ctatttgaaatgcacgagaaactaagttgtatggcaaactctgtaataaaaaatctacag
tcacgttggagatcaccatcccatgaaaattctatttag

DBGET integrated database retrieval system