KEGG   Homo sapiens (human): 55236
Entry
55236             CDS       T01001                                 
Symbol
UBA6, E1-L2, MOP-4, UBE1L2
Name
(RefSeq) ubiquitin like modifier activating enzyme 6
  KO
K10699  ubiquitin-activating enzyme E1-like protein 2 [EC:6.2.1.45]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    55236 (UBA6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    55236 (UBA6)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.45  E1 ubiquitin-activating enzyme
     55236 (UBA6)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   55236 (UBA6)
SSDB
Motif
Pfam: ThiF UBA_E1_SCCH E1_FCCH E1_4HB E1_UFD Shikimate_DH
Other DBs
NCBI-GeneID: 55236
NCBI-ProteinID: NP_060697
OMIM: 611361
HGNC: 25581
Ensembl: ENSG00000033178
Pharos: A0AVT1(Tchem)
UniProt: A0AVT1 A1LT96
Structure
LinkDB
Position
4:complement(67612652..67701155)
AA seq 1052 aa
MEGSEPVAAHQGEEASCSSWGTGSTNKNLPIMSTASVEIDDALYSRQRYVLGDTAMQKMA
KSHVFLSGMGGLGLEIAKNLVLAGIKAVTIHDTEKCQAWDLGTNFFLSEDDVVNKRNRAE
AVLKHIAELNPYVHVTSSSVPFNETTDLSFLDKYQCVVLTEMKLPLQKKINDFCRSQCPP
IKFISADVHGIWSRLFCDFGDEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLE
TGQFLTFREINGMTGLNGSIQQITVISPFSFSIGDTTELEPYLHGGIAVQVKTPKTVFFE
SLERQLKHPKCLIVDFSNPEAPLEIHTAMLALDQFQEKYSRKPNVGCQQDSEELLKLATS
ISETLEEKPDVNADIVHWLSWTAQGFLSPLAAAVGGVASQEVLKAVTGKFSPLCQWLYLE
AADIVESLGKPECEEFLPRGDRYDALRACIGDTLCQKLQNLNIFLVGCGAIGCEMLKNFA
LLGVGTSKEKGMITVTDPDLIEKSNLNRQFLFRPHHIQKPKSYTAADATLKINSQIKIDA
HLNKVCPTTETIYNDEFYTKQDVIITALDNVEARRYVDSRCLANLRPLLDSGTMGTKGHT
EVIVPHLTESYNSHRDPPEEEIPFCTLKSFPAAIEHTIQWARDKFESSFSHKPSLFNKFW
QTYSSAEEVLQKIQSGHSLEGCFQVIKLLSRRPRNWSQCVELARLKFEKYFNHKALQLLH
CFPLDIRLKDGSLFWQSPKRPPSPIKFDLNEPLHLSFLQNAAKLYATVYCIPFAEEDLSA
DALLNILSEVKIQEFKPSNKVVQTDETARKPDHVPISSEDERNAIFQLEKAILSNEATKS
DLQMAVLSFEKDDDHNGHIDFITAASNLRAKMYSIEPADRFKTKRIAGKIIPAIATTTAT
VSGLVALEMIKVTGGYPFEAYKNCFLNLAIPIVVFTETTEVRKTKIRNGISFTIWDRWTV
HGKEDFTLLDFINAVKEKYGIEPTMVVQGVKMLYVPVMPGHAKRLKLTMHKLVKPTTEKK
YVDLTVSFAPDIDGDEDLPGPPVRYYFSHDTD
NT seq 3159 nt   +upstreamnt  +downstreamnt
atggaaggatccgagcctgtggccgcccatcagggggaagaggcgtcctgttcttcctgg
gggactggcagcacaaataaaaatttgcccattatgtcaacagcatctgtggaaatcgat
gatgcattgtatagtcgacagaggtacgttcttggagacacagcaatgcagaagatggcc
aagtcccatgttttcttaagtgggatgggtggtcttggtttggaaattgcaaagaatctt
gttcttgcagggattaaggcagttacaattcatgatacagaaaaatgccaagcatgggat
ctaggaaccaacttctttctcagtgaagatgatgttgttaataagagaaacagggctgaa
gctgtacttaaacatattgcagaactaaatccatacgttcatgtcacatcatcttctgtt
cctttcaatgagaccacagatctctcctttttagataaataccagtgtgtagtattgact
gagatgaaacttccattgcagaagaagatcaatgacttttgccgttctcagtgccctcca
attaagtttatcagtgcagatgtacatggaatttggtcaaggttattttgtgatttcggt
gatgaatttgaagttttagatacaacaggagaagaaccaaaagaaattttcatttcaaac
ataacgcaagcaaatcctggcattgttacttgccttgaaaatcatcctcacaaactggag
acaggacaattcctaacatttcgagaaattaatggaatgacaggtttaaatggatctata
caacaaataacggtgatatcgccattttcttttagtattggtgacaccacagaactggaa
ccatatttacatggaggcatagctgtccaagttaagactcctaaaacagttttttttgaa
tcactggagaggcagttaaaacatccaaagtgccttattgtggattttagcaaccctgag
gcacctttagagattcacacagctatgcttgccttggaccagtttcaggagaaatacagt
cgcaagccaaatgttggatgccaacaagattcagaagaactgttgaaactagcaacatct
ataagtgaaaccttggaagagaagcctgatgtaaatgctgacattgtgcattggctctct
tggactgcccaaggctttttatctccacttgctgcagcagtaggaggtgttgccagccaa
gaagtattgaaagctgtaacaggaaaattttctcctttgtgccagtggttatatcttgaa
gcagcagatattgttgaatcactaggcaaacctgaatgtgaagaatttctcccacgagga
gatagatatgatgccttaagagcttgcattggagacactttgtgtcagaaactgcaaaat
ttaaacatcttcttagtagggtgtggagccataggctgtgaaatgttgaaaaattttgct
ttacttggtgttggcacaagcaaagagaaaggaatgattacagttacagatcctgacttg
atagagaaatccaacttaaatagacagttcctatttcgtcctcatcacatacagaaacct
aaaagctacactgctgctgatgctactctgaaaataaattctcaaataaagatagatgca
cacctgaacaaagtatgtccaaccactgagaccatttacaatgatgagttctatactaaa
caagatgtaattattacagcattagataatgtggaagccaggagatacgtagacagtcgt
tgcttagcaaatctaaggcctcttttagattctggaacaatgggcactaagggacacact
gaagttattgtaccgcatttgactgagtcttacaatagtcatcgggatcccccagaagag
gaaataccattttgtactctaaaatcctttccagctgctattgaacataccatacagtgg
gcaagagataagtttgaaagttccttttcccacaaaccttcattgtttaacaaattttgg
caaacctattcatctgcagaagaagtcttacagaagatacagagtggacacagtttagaa
ggctgttttcaagttataaagttacttagcagaagacctagaaattggtcccagtgtgta
gaattagcaagattaaagtttgaaaaatattttaaccataaggctcttcagcttcttcac
tgtttccctctggacatacgattaaaagatggcagtttattttggcagtcaccaaagagg
ccaccctctccaataaaatttgatttaaatgagcctttgcacctcagtttccttcagaat
gctgcaaaactatatgctacagtatattgtattccatttgcagaagaggacttatcagca
gatgccctcttgaatattctttcagaagtaaagattcaggaattcaagccttccaataag
gttgttcaaacagatgaaactgcaaggaaaccagaccatgttcctattagcagtgaagat
gagaggaatgcaattttccaactagaaaaggctattttatctaatgaagccaccaaaagt
gaccttcagatggcagtgctttcatttgaaaaagatgatgatcataatggacacatagat
ttcatcacagctgcatcaaatcttcgtgccaaaatgtacagcattgaaccagctgaccgt
ttcaaaacaaagcgcatagctggtaaaattatacctgctatagcaacaaccactgctaca
gtttctggcttggttgccttggagatgatcaaagtaactggtggctatccatttgaagct
tacaaaaattgttttcttaacttagccattccaattgtagtatttacagagacaactgaa
gtaaggaaaactaaaatcagaaatggaatatcatttacaatttgggatcgatggaccgta
catggaaaagaagatttcaccctcttggatttcataaatgcagtcaaagagaagtatgga
attgagccaacaatggtggtacagggagtcaaaatgctttatgttcctgtaatgcctggt
catgcaaaaagattgaagttaacaatgcataaacttgtaaaacctactactgaaaagaaa
tatgtggatcttactgtgtcatttgctccagacattgatggagatgaagatttgccggga
cctccagtaagatactacttcagtcatgacactgattaa

KEGG   Homo sapiens (human): 7317
Entry
7317              CDS       T01001                                 
Symbol
UBA1, A1S9, A1S9T, A1ST, AMCX1, CFAP124, GXP1, POC20, SMAX2, UBA1A, UBE1, UBE1X, VEXAS
Name
(RefSeq) ubiquitin like modifier activating enzyme 1
  KO
K03178  ubiquitin-activating enzyme E1 [EC:6.2.1.45]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa05012  Parkinson disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Disease
H00455  Spinal muscular atrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7317 (UBA1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    7317 (UBA1)
   05022 Pathways of neurodegeneration - multiple diseases
    7317 (UBA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7317 (UBA1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7317 (UBA1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.45  E1 ubiquitin-activating enzyme
     7317 (UBA1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-activating enzymes (E1)
  Ubiquitin activating enzyme
   7317 (UBA1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   7317 (UBA1)
  Exosomal proteins of other body fluids (saliva and urine)
   7317 (UBA1)
  Exosomal proteins of colorectal cancer cells
   7317 (UBA1)
SSDB
Motif
Pfam: ThiF UBA_E1_SCCH E1_UFD E1_FCCH E1_4HB PAZ
Other DBs
NCBI-GeneID: 7317
NCBI-ProteinID: NP_003325
OMIM: 314370
HGNC: 12469
Ensembl: ENSG00000130985
Pharos: P22314(Tbio)
UniProt: P22314 A0A024R1A3
Structure
LinkDB
Position
X:47190847..47215128
AA seq 1058 aa
MSSSPLSKKRRVSGPDPKPGSNCSPAQSVLSEVPSVPTNGMAKNGSEADIDEGLYSRQLY
VLGHEAMKRLQTSSVLVSGLRGLGVEIAKNIILGGVKAVTLHDQGTAQWADLSSQFYLRE
EDIGKNRAEVSQPRLAELNSYVPVTAYTGPLVEDFLSGFQVVVLTNTPLEDQLRVGEFCH
NRGIKLVVADTRGLFGQLFCDFGEEMILTDSNGEQPLSAMVSMVTKDNPGVVTCLDEARH
GFESGDFVSFSEVQGMVELNGNQPMEIKVLGPYTFSICDTSNFSDYIRGGIVSQVKVPKK
ISFKSLVASLAEPDFVVTDFAKFSRPAQLHIGFQALHQFCAQHGRPPRPRNEEDAAELVA
LAQAVNARALPAVQQNNLDEDLIRKLAYVAAGDLAPINAFIGGLAAQEVMKACSGKFMPI
MQWLYFDALECLPEDKEVLTEDKCLQRQNRYDGQVAVFGSDLQEKLGKQKYFLVGAGAIG
CELLKNFAMIGLGCGEGGEIIVTDMDTIEKSNLNRQFLFRPWDVTKLKSDTAAAAVRQMN
PHIRVTSHQNRVGPDTERIYDDDFFQNLDGVANALDNVDARMYMDRRCVYYRKPLLESGT
LGTKGNVQVVIPFLTESYSSSQDPPEKSIPICTLKNFPNAIEHTLQWARDEFEGLFKQPA
ENVNQYLTDPKFVERTLRLAGTQPLEVLEAVQRSLVLQRPQTWADCVTWACHHWHTQYSN
NIRQLLHNFPPDQLTSSGAPFWSGPKRCPHPLTFDVNNPLHLDYVMAAANLFAQTYGLTG
SQDRAAVATFLQSVQVPEFTPKSGVKIHVSDQELQSANASVDDSRLEELKATLPSPDKLP
GFKMYPIDFEKDDDSNFHMDFIVAASNLRAENYDIPSADRHKSKLIAGKIIPAIATTTAA
VVGLVCLELYKVVQGHRQLDSYKNGFLNLALPFFGFSEPLAAPRHQYYNQEWTLWDRFEV
QGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVS
RVSKRKLGRHVRALVLELCCNDESGEDVEVPYVRYTIR
NT seq 3177 nt   +upstreamnt  +downstreamnt
atgtccagctcgccgctgtccaagaaacgtcgcgtgtccgggcctgatccaaagccgggt
tctaactgctcccctgcccagtccgtgttgtccgaagtgccctcggtgccaaccaacgga
atggccaagaacggcagtgaagcagacatagacgagggcctttactcccggcagctgtat
gtgttgggccatgaggcaatgaagcggctccagacatccagtgtcctggtatcaggcctg
cggggcctgggcgtggagatcgctaagaacatcatccttggtggggtcaaggctgttacc
ctacatgaccagggcactgcccagtgggctgatctttcctcccagttctacctgcgggag
gaggacatcggtaaaaaccgggccgaggtatcacagccccgcctcgctgagctcaacagc
tatgtgcctgtcactgcctacactggacccctcgttgaggacttccttagtggtttccag
gtggtggtgctcaccaacacccccctggaggaccagctgcgagtgggtgagttctgtcac
aaccgtggcatcaagctggtggtggcagacacgcggggcctgtttgggcagctcttctgt
gactttggagaggaaatgatcctcacagattccaatggggagcagccactcagtgctatg
gtttctatggttaccaaggacaaccccggtgtggttacctgcctggatgaggcccgacac
gggtttgagagcggggactttgtctccttttcagaagtacagggcatggttgaactcaac
ggaaatcagcccatggagatcaaagtcctgggtccttatacctttagcatctgtgacacc
tccaacttctccgactacatccgtggaggcatcgtcagtcaggtcaaagtacctaagaag
attagctttaaatccttggtggcctcactggcagaacctgactttgtggtgacggacttc
gccaagttttctcgccctgcccagctgcacattggcttccaggccctgcaccagttctgt
gctcagcatggccggccacctcggccccgcaatgaggaggatgcagcagaactggtagcc
ttagcacaggctgtgaatgctcgagccctgccagcagtgcagcaaaataacctggacgag
gacctcatccggaagctggcatatgtggctgctggggatctggcacccataaacgccttc
attgggggcctggctgcccaggaagtcatgaaggcctgctccgggaagttcatgcccatc
atgcagtggctatactttgatgcccttgagtgtctccctgaggacaaagaggtcctcaca
gaggacaagtgcctccagcgccagaaccgttatgacgggcaagtggctgtgtttggctca
gacctgcaagagaagctgggcaagcagaagtatttcctggtgggtgcgggggccattggc
tgtgagctgctcaagaactttgccatgattgggctgggctgcggggagggtggagaaatc
atcgttacagacatggacaccattgagaagtcaaatctgaatcgacagtttcttttccgg
ccctgggatgtcacgaagttaaagtctgacacggctgctgcagctgtgcgccaaatgaat
ccacatatccgggtgacaagccaccagaaccgtgtgggtcctgacacggagcgcatctat
gatgacgattttttccaaaacctagatggcgtggccaatgccctggacaacgtggatgcc
cgcatgtacatggaccgccgctgtgtctactaccggaagccactgctggagtcaggcaca
ctgggcaccaaaggcaatgtgcaggtggtgatccccttcctgacagagtcgtacagttcc
agccaggacccacctgagaagtccatccccatctgtaccctgaagaacttccctaatgcc
atcgagcacaccctgcagtgggctcgggatgagtttgaaggcctcttcaagcagccagca
gaaaatgtcaaccagtacctcacagaccccaagtttgtggagcgaacactgcggctggca
ggcactcagcccttggaggtgctggaggctgtgcagcgcagcctggtgctgcagcgacca
cagacctgggctgactgcgtgacctgggcctgccaccactggcacacccagtactcgaac
aacatccggcagctgctgcacaacttccctcctgaccagctcacaagctcaggagcgccg
ttctggtctgggcccaaacgctgtccacacccgctcacctttgatgtcaacaatcccctg
catctggactatgtgatggctgctgccaacctgtttgcccagacctacgggctgacaggc
tctcaggaccgagctgctgtggccacattcctgcagtctgtgcaggtccccgaattcacc
cccaagtctggcgtcaagatccatgtttctgaccaggagctgcagagcgccaatgcctct
gttgatgacagtcgtctagaggagctcaaagccactctgcccagcccagacaagctccct
ggattcaagatgtaccccattgactttgagaaggatgatgacagcaactttcatatggat
ttcatcgtggctgcatccaacctccgggcagaaaactatgacattccttctgcagaccgg
cacaagagcaagctgattgcagggaagatcatcccagccattgccacgaccacagcagcc
gtggttggccttgtgtgtctggagctgtacaaggttgtgcaggggcaccgacagcttgac
tcctacaagaatggtttcctcaacttggccctgcctttctttggtttctctgaacccctt
gccgcaccacgtcaccagtactataaccaagagtggacattgtgggatcgctttgaggta
caagggctgcagcctaatggtgaggagatgaccctcaaacagttcctcgactattttaag
acagagcacaaattagagatcaccatgctgtcccagggcgtgtccatgctctattccttc
ttcatgccagctgccaagctcaaggaacggttggatcagccgatgacagagattgtgagc
cgtgtgtcgaagcgaaagctgggccgccacgtgcgggcgctggtgcttgagctgtgctgt
aacgacgagagcggcgaggatgtcgaggttccctatgtccgatacaccatccgctga

KEGG   Homo sapiens (human): 7318
Entry
7318              CDS       T01001                                 
Symbol
UBA7, D8, UBA1B, UBE1L, UBE2, UBE7
Name
(RefSeq) ubiquitin like modifier activating enzyme 7
  KO
K10698  ubiquitin-activating enzyme E1-like [EC:6.2.1.45]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa05012  Parkinson disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    7318 (UBA7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    7318 (UBA7)
   05022 Pathways of neurodegeneration - multiple diseases
    7318 (UBA7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    7318 (UBA7)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.45  E1 ubiquitin-activating enzyme
     7318 (UBA7)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   7318 (UBA7)
SSDB
Motif
Pfam: ThiF UBA_E1_SCCH E1_UFD E1_FCCH E1_4HB dCache_3
Other DBs
NCBI-GeneID: 7318
NCBI-ProteinID: NP_003326
OMIM: 191325
HGNC: 12471
Ensembl: ENSG00000182179
Pharos: P41226(Tbio)
UniProt: P41226
LinkDB
Position
3:complement(49805209..49813953)
AA seq 1012 aa
MDALDASKLLDEELYSRQLYVLGSPAMQRIQGARVLVSGLQGLGAEVAKNLVLMGVGSLT
LHDPHPTCWSDLAAQFLLSEQDLERSRAEASQELLAQLNRAVQVVVHTGDITEDLLLDFQ
VVVLTAAKLEEQLKVGTLCHKHGVCFLAADTRGLVGQLFCDFGEDFTVQDPTEAEPLTAA
IQHISQGSPGILTLRKGANTHYFRDGDLVTFSGIEGMVELNDCDPRSIHVREDGSLEIGD
TTTFSRYLRGGAITEVKRPKTVRHKSLDTALLQPHVVAQSSQEVHHAHCLHQAFCALHKF
QHLHGRPPQPWDPVDAETVVGLARDLEPLKRTEEEPLEEPLDEALVRTVALSSAGVLSPM
VAMLGAVAAQEVLKAISRKFMPLDQWLYFDALDCLPEDGELLPSPEDCALRGSRYDGQIA
VFGAGFQEKLRRQHYLLVGAGAIGCELLKVFALVGLGAGNSGGLTVVDMDHIERSNLSRQ
FLFRSQDVGRPKAEVAAAAARGLNPDLQVIPLTYPLDPTTEHIYGDNFFSRVDGVAAALD
SFQARRYVAARCTHYLKPLLEAGTSGTWGSATVFMPHVTEAYRAPASAAASEDAPYPVCT
VRYFPSTAEHTLQWARHEFEELFRLSAETINHHQQAHTSLADMDEPQTLTLLKPVLGVLR
VRPQNWQDCVAWALGHWKLCFHYGIKQLLRHFPPNKVLEDGTPFWSGPKQCPQPLEFDTN
QDTHLLYVLAAANLYAQMHGLPGSQDWTALRELLKLLPQPDPQQMAPIFASNLELASASA
EFGPEQQKELNKALEVWSVGPPLKPLMFEKDDDSNFHVDFVVAAASLRCQNYGIPPVNRA
QSKRIVGQIIPAIATTTAAVAGLLGLELYKVVSGPRPRSAFRHSYLHLAENYLIRYMPFA
PAIQTFHHLKWTSWDRLKVPAGQPERTLESLLAHLQEQHGLRVRILLHGSALLYAAGWSP
EKQAQHLPLRVTELVQQLTGQAPAPGQRVLVLELSCEGDDEDTAFPPLHYEL
NT seq 3039 nt   +upstreamnt  +downstreamnt
atggatgccctggacgcttcgaagctactggatgaggagctgtattcaagacagctgtat
gtgctgggctcacctgccatgcagaggattcagggagccagggtcctggtgtcaggcctg
cagggcctgggggccgaggtggccaagaacttggttctgatgggtgtgggcagcctcact
ctgcatgatccccaccccacctgctggtccgacctggctgcccagtttctcctctcagag
caggacttggaaaggagcagagccgaggcctctcaagagctcttggctcagctcaacaga
gctgtccaggtcgtcgtgcacacgggtgacatcactgaggacctgctgttggacttccag
gtggtggtgctgactgctgcaaagctggaggagcagctgaaggtgggcaccttgtgtcat
aagcatggagtttgctttctggcggctgacacccggggcctcgtggggcagttgttctgt
gactttggtgaggacttcactgtgcaggaccccacagaggcagaacccctgacagctgcc
atccagcacatctcccagggctcccctggcattctcactctgaggaaaggggccaatacc
cactacttccgtgatggagacttggtgactttctcgggaattgagggaatggttgagctc
aacgactgtgatccccggtctatccacgtgcgggaggatgggtccctggagattggagac
acaacaactttctctcggtacttgcgtggtggggctatcactgaagtcaagagacccaag
actgtgagacataagtccctggacacagccctgctccagccccatgtggtggcccagagc
tcccaggaagttcaccatgcccactgcctgcatcaggccttctgtgcactgcacaagttc
cagcacctccatggccggccaccccagccctgggatcctgttgatgcagagactgtggtg
ggcctggcccgggacctggaaccactgaagcggacagaggaagagccactggaagagcca
ctggatgaggccctagtgcggacagtcgccctaagcagtgcaggtgtcttgagccctatg
gtggccatgctgggtgcagtagctgcccaggaagtgctgaaggcaatctccaggaagttc
atgcctctggaccagtggctttactttgatgccctcgattgtcttccggaagatggggag
ctccttcccagtcctgaggactgtgccctgagaggcagccgctatgatgggcaaattgca
gtgtttggggctggttttcaggagaaactgagacgccagcactacctcctggtgggcgct
ggtgccattggttgtgagctgctcaaagtctttgccctagtgggactgggggccgggaac
agcgggggcttgactgttgttgacatggaccacatagagcgctccaatctcagccgtcag
ttcctcttcaggtcccaggacgttggtagacccaaggcagaggtggctgcagcagctgcc
cggggcctgaacccagacttacaggtgatcccgctcacctacccactggatcccaccaca
gagcacatctatggggataactttttctcccgtgtggatggtgtggctgctgccctggac
agtttccaggcccggcgctatgtggctgctcgttgcacccactatctgaagccactgctg
gaggcaggcacatcgggcacctggggcagtgctacagtattcatgccacatgtgactgag
gcctacagagcccctgcctcagctgcagcttctgaggatgccccctaccctgtctgtacc
gtgcggtacttccctagcacagccgagcacaccctgcagtgggcccggcatgagtttgaa
gaactcttccgactgtctgcagagaccatcaaccaccaccaacaggcacacacttccctg
gcagacatggatgagccacagacactcaccttactgaagccagtgcttggggtcctgaga
gtgcgtccacagaactggcaagactgtgtggcgtgggctcttggccactggaaactctgc
tttcattatggcatcaaacagctgctgaggcacttcccacctaataaagtgcttgaggat
ggaactcccttctggtcaggtcccaaacagtgtccccagcccttggagtttgacaccaac
caagacacacacctcctctacgtactggcagctgccaacctgtatgcccagatgcatggg
ctgcctggctcacaggactggactgcactcagggagctgctgaagctgctgccacagcct
gacccccaacagatggcccccatctttgctagtaatctagagctggcttcggcttctgct
gagtttggccctgagcagcagaaggaactgaacaaagccctggaagtctggagtgtgggc
cctcccctgaagcctctgatgtttgagaaggatgatgacagcaacttccatgtggacttt
gtggtagcggcagctagcctgagatgtcagaactacgggattccaccggtcaaccgtgcc
cagagcaagcgaattgtgggccagattatcccagccattgccaccactacagcagctgtg
gcaggcctgttgggcctggagctgtataaggtggtgagtgggccacggcctcgtagtgcc
tttcgccacagctacctacatctggctgaaaactacctcatccgctatatgccttttgcc
ccagccatccagacgttccatcacctgaagtggacctcttgggaccgtctgaaggtacca
gctgggcagcctgagaggaccctggagtcgctgctggctcatcttcaggagcagcacggg
ttgagggtgaggatcctgctgcacggctcagccctgctctatgcggccggatggtcacct
gaaaagcaggcccagcacctgcccctcagggtgacagaactggttcagcagctgacaggc
caggcacctgctcctgggcagcgggtgttggtgctagagctgagctgtgagggtgacgac
gaggacactgccttcccacctctgcactatgagctgtga

DBGET integrated database retrieval system