KEGG   Homo sapiens (human): 5525
Entry
5525              CDS       T01001                                 

Gene name
PPP2R5A, B56A, B56alpha, PR61A
Definition
(RefSeq) protein phosphatase 2 regulatory subunit B'alpha
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04728  Dopaminergic synapse
hsa05165  Human papillomavirus infection
Network
nt06114  PI3K signaling (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5525 (PPP2R5A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    5525 (PPP2R5A)
   04151 PI3K-Akt signaling pathway
    5525 (PPP2R5A)
   04152 AMPK signaling pathway
    5525 (PPP2R5A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    5525 (PPP2R5A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5525 (PPP2R5A)
  09156 Nervous system
   04728 Dopaminergic synapse
    5525 (PPP2R5A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    5525 (PPP2R5A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5525 (PPP2R5A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5525 (PPP2R5A)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5525 (PPP2R5A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5525 (PPP2R5A)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     5525 (PPP2R5A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5525 (PPP2R5A)
SSDB
Motif
Pfam: B56 Sec7_N
Other DBs
NCBI-GeneID: 5525
NCBI-ProteinID: NP_006234
OMIM: 601643
HGNC: 9309
Ensembl: ENSG00000066027
Vega: OTTHUMG00000036750
Pharos: Q15172(Tchem)
UniProt: Q15172
LinkDB
Position
1q32.3
AA seq 486 aa
MSSSSPPAGAASAAISASEKVDGFTRKSVRKAQRQKRSQGSSQFRSQGSQAELHPLPQLK
DATSNEQQELFCQKLQQCCILFDFMDSVSDLKSKEIKRATLNELVEYVSTNRGVIVESAY
SDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASWPHIQLVYEFFLRFLESPDFQPSIA
KRYIDQKFVQQLLELFDSEDPRERDFLKTVLHRIYGKFLGLRAFIRKQINNIFLRFIYET
EHFNGVAELLEILGSIINGFALPLKAEHKQFLMKVLIPMHTAKGLALFHAQLAYCVVQFL
EKDTTLTEPVIRGLLKFWPKTCSQKEVMFLGEIEEILDVIEPTQFKKIEEPLFKQISKCV
SSSHFQVAERALYFWNNEYILSLIEENIDKILPIMFASLYKISKEHWNPTIVALVYNVLK
TLMEMNGKLFDDLTSSYKAERQREKKKELEREELWKKLEELKLKKALEKQNSAYNMHSIL
SNTSAE
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgtcgtcgtcgtcgccgccggcgggggctgccagcgccgccatctcggcctcggagaaa
gtggacggcttcacccggaaatcggtccgcaaggcgcagaggcagaagcgctcccagggc
tcgtcgcagtttcgcagccagggcagccaggcagagctgcacccgctgccccagctcaaa
gatgccacttcaaatgaacaacaagagcttttctgtcagaagttgcagcagtgttgtata
ctgtttgatttcatggactctgtttcagacttgaagagcaaagaaattaaaagagcaaca
ctgaatgaactggttgagtatgtttcaactaatcgtggtgtaattgttgaatcagcgtat
tctgatatagtaaaaatgatcagtgctaacatcttccgtacacttcctccaagtgataat
ccagattttgatccagaagaggatgaacccacgcttgaggcctcttggcctcacatacag
ttggtatatgaattcttcttgagatttttggagagccctgatttccagcctagcattgca
aaacgatacattgatcagaaattcgtacaacagctcctggagctttttgatagtgaagat
cccagagaacgtgacttcctgaagactgttctgcaccgaatttatgggaaatttcttgga
ttaagagcattcatcagaaaacaaattaacaacattttcctcaggtttatatatgaaaca
gaacatttcaatggtgttgctgaacttcttgaaatattaggaagtattatcaatggcttt
gcattgccactgaaagcagaacataaacaatttctaatgaaggttcttattcctatgcat
actgcaaaaggattagctttgtttcatgctcagctagcatattgtgttgtacagttcctg
gagaaagatacaacactaacagagccagtgatcagaggactgctgaaattttggccaaaa
acctgcagtcagaaagaggtgatgtttttaggagaaattgaagaaatcttagatgtcatt
gaaccaacacagttcaaaaaaattgaagagccacttttcaagcagatatccaagtgtgta
tccagttctcattttcaggttgcagaaagggcattgtacttctggaataacgaatatatt
cttagtttgattgaggagaacattgataaaattctgccaattatgtttgccagtttgtac
aaaatttccaaagaacactggaatccgaccattgtagcactggtatacaatgtgctgaaa
accctaatggaaatgaatggcaagcttttcgatgaccttactagctcatacaaagctgaa
agacagagagagaaaaagaaggaattggaacgtgaagaattatggaaaaaattagaggag
ctaaagctaaagaaagctctagaaaaacagaatagtgcttacaacatgcacagtattctc
agcaatacaagtgccgaataa

KEGG   Homo sapiens (human): 5526
Entry
5526              CDS       T01001                                 

Gene name
PPP2R5B, B56B, B56beta, PR61B
Definition
(RefSeq) protein phosphatase 2 regulatory subunit B'beta
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04728  Dopaminergic synapse
hsa05165  Human papillomavirus infection
Network
nt06114  PI3K signaling (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5526 (PPP2R5B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    5526 (PPP2R5B)
   04151 PI3K-Akt signaling pathway
    5526 (PPP2R5B)
   04152 AMPK signaling pathway
    5526 (PPP2R5B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    5526 (PPP2R5B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5526 (PPP2R5B)
  09156 Nervous system
   04728 Dopaminergic synapse
    5526 (PPP2R5B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    5526 (PPP2R5B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5526 (PPP2R5B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5526 (PPP2R5B)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5526 (PPP2R5B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5526 (PPP2R5B)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     5526 (PPP2R5B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5526 (PPP2R5B)
SSDB
Motif
Pfam: B56 FTCD_C
Other DBs
NCBI-GeneID: 5526
NCBI-ProteinID: NP_006235
OMIM: 601644
HGNC: 9310
Ensembl: ENSG00000068971
Vega: OTTHUMG00000150043
Pharos: Q15173(Tbio)
UniProt: Q15173 A0A024R593
LinkDB
Position
11q13.1
AA seq 497 aa
METKLPPASTPTSPSSPGLSPVPPPDKVDGFSRRSLRRARPRRSHSSSQFRYQSNQQELT
PLPLLKDVPASELHELLSRKLAQCGVMFDFLDCVADLKGKEVKRAALNELVECVGSTRGV
LIEPVYPDIIRMISVNIFRTLPPSENPEFDPEEDEPNLEPSWPHLQLVYEFFLRFLESPD
FQPSVAKRYVDQKFVLMLLELFDSEDPREREYLKTILHRVYGKFLGLRAYIRKQCNHIFL
RFIYEFEHFNGVAELLEILGSIINGFALPLKTEHKQFLVRVLIPLHSVKSLSVFHAQLAY
CVVQFLEKDATLTEHVIRGLLKYWPKTCTQKEVMFLGEMEEILDVIEPSQFVKIQEPLFK
QVARCVSSPHFQVAERALYFWNNEYILSLIEDNCHTVLPAVFGTLYQVSKEHWNQTIVSL
IYNVLKTFMEMNGKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKE
APLQRLTPQVAASGGQS
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggagacgaagctgccccctgcaagcacccccactagcccctcctcccccgggctgtcg
cctgtgcccccacccgacaaggtggacggcttctcccgccgttccctccgcagagcccgg
ccccgccgctcccacagctcctctcagttccgctatcagagcaaccagcaagagctcaca
ccgctgcccctgctcaaagatgtgccggcttccgagctgcacgagctgctgagccggaag
ctggcccagtgtggggtgatgtttgacttcttggactgtgtggccgacctcaaggggaag
gaggtgaagcgggcagccctcaacgagctggtggagtgtgtggggagcacccggggtgtc
ctcatcgagcccgtctacccagacatcatccgcatgatctcagtgaatatcttccggact
ctgccgcccagtgagaaccctgaatttgaccctgaagaggatgagcccaatcttgagcct
tcgtggccacacctgcagctggtatatgagtttttcctgcgtttcttggagagcccagac
ttccagccctccgtggccaagagatatgtggatcaaaagtttgtcctgatgctcctggag
ctatttgatagtgaggatccccgggagcgtgagtacctcaagaccatcctgcaccgggtc
tatggcaagttcctgggtctccgggcctacatccgcaaacagtgcaaccacatcttcctc
cggttcatctatgaattcgagcacttcaatggtgtggctgagctgctggagatcctagga
agcatcatcaatggctttgcgctgcccctgaagacggagcacaagcagttcctggttcgc
gtcctgatccccctgcactctgtcaagtcgctgtctgtcttccatgcccagctggcatac
tgtgtggtgcagttcctggagaaggatgccactctgacagagcacgtgatccgggggctg
ctcaaatactggccaaaaacctgcacccagaaggaggtgatgtttctgggggagatggaa
gagattcttgatgtcatcgagccctcccagtttgtgaagatccaggagcccctttttaag
caggtggctcgctgtgtttccagcccccatttccaggttgcagagcgggctctgtatttc
tggaacaatgagtatatcctaagcctcattgaggacaactgccacactgtgctgcctgct
gtgtttgggaccctctaccaagtctccaaggagcactggaaccaaaccatcgtatcactg
atctacaatgtgctcaagaccttcatggagatgaatgggaagctgtttgatgagctcaca
gcctcctacaagctggaaaagcagcaggagcagcagaaggcccaggagcgtcaggagtta
tggcaaggtctggaggagctgcggctacgccggctacaggggacccagggggccaaggag
gcccccctccagcggcttacaccccaggtggccgccagtgggggtcagagctag

KEGG   Homo sapiens (human): 5527
Entry
5527              CDS       T01001                                 

Gene name
PPP2R5C, B56G, B56gamma, PR61G
Definition
(RefSeq) protein phosphatase 2 regulatory subunit B'gamma
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04728  Dopaminergic synapse
hsa05165  Human papillomavirus infection
Network
nt06114  PI3K signaling (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5527 (PPP2R5C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    5527 (PPP2R5C)
   04151 PI3K-Akt signaling pathway
    5527 (PPP2R5C)
   04152 AMPK signaling pathway
    5527 (PPP2R5C)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    5527 (PPP2R5C)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5527 (PPP2R5C)
  09156 Nervous system
   04728 Dopaminergic synapse
    5527 (PPP2R5C)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    5527 (PPP2R5C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5527 (PPP2R5C)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5527 (PPP2R5C)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5527 (PPP2R5C)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5527 (PPP2R5C)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     5527 (PPP2R5C)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5527 (PPP2R5C)
SSDB
Motif
Pfam: B56 DUF1616
Other DBs
NCBI-GeneID: 5527
NCBI-ProteinID: NP_002710
OMIM: 601645
HGNC: 9311
Ensembl: ENSG00000078304
Vega: OTTHUMG00000171597
Pharos: Q13362(Tbio)
UniProt: Q13362
LinkDB
Structure
PDB: 

Position
14q32.31
AA seq 524 aa
MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPL
SDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDP
EEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERD
FLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLK
EEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVMALLKYWPKTHSPK
EVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLIS
DNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEK
LKMKEREEAWVKIENLAKANPQYTVYSQASTMSIPVAMETDGPLFEDVQMLRKTVKDEAH
QAQKDPKKDRPLARRKSELPQDPHTKKALEAHCRADELASQDGR
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgttgacatgtaataaagcgggcagcaggatggtggtggatgcggccaactccaatggg
cctttccagcccgtggtccttctccatattcgagatgttcctcctgctgatcaagagaag
ctttttatccagaagttacgtcagtgttgcgtcctctttgactttgtttctgatccacta
agtgacctaaagtggaaggaagtaaaacgagctgctttaagtgaaatggtagaatatatc
acccataatcggaatgtgatcacagagcctatttacccagaagtagtccatatgtttgca
gttaacatgtttcgaacattaccaccttcctccaatcctacgggagcggaatttgacccg
gaggaagatgaaccaacgttagaagcagcctggcctcatctacagcttgtttatgaattt
ttcttaagatttttagagtctccagatttccaacctaatatagcgaagaaatatattgat
cagaagtttgtattgcagcttttagagctctttgacagtgaagatcctcgggagagagat
tttcttaaaaccacccttcacagaatctatgggaaattcctaggcttgagagcttacatc
agaaaacagataaataatatattttataggtttatttatgaaacagagcatcataatggc
atagcagagttactggaaatattgggaagtataattaatggatttgccttaccactaaaa
gaagagcacaagattttcttattgaaggtgttactacctttgcacaaagtgaaatctctg
agtgtctaccatccccagctggcatactgtgtagtgcagtttttagaaaaggacagcacc
ctcacggaaccagtggtgatggcacttctcaaatactggccaaagactcacagtccaaaa
gaagtaatgttcttaaacgaattagaagagattttagatgtcattgaaccatcagaattt
gtgaagatcatggaacccctcttccggcagttggccaaatgtgtctccagcccacacttc
caggtggcagagcgagctctctattactggaataatgaatacatcatgagtttaatcagt
gacaacgcagcgaagattctgcccatcatgtttccttccttgtaccgcaactcaaagacc
cattggaacaagacaatacatggcttgatatacaacgccctgaagctcttcatggagatg
aaccaaaagctatttgatgactgtacacaacagttcaaagcagagaaactaaaagagaag
ctaaaaatgaaagaacgggaagaagcatgggttaaaatagaaaatctagccaaagccaat
ccccagtacacagtgtatagtcaagccagcaccatgagcattccggttgcaatggagaca
gatgggcctttatttgaagatgtgcagatgctgagaaagacagtgaaggacgaggctcat
caggcacagaaagatccgaagaaggaccgtcctcttgcacgccgcaagtccgagctgcct
caggacccccacaccaagaaagccttggaagctcactgcagggccgatgagctggcctcc
caggacggccgctag

KEGG   Homo sapiens (human): 5528
Entry
5528              CDS       T01001                                 

Gene name
PPP2R5D, B56D, B56delta, MRD35
Definition
(RefSeq) protein phosphatase 2 regulatory subunit B'delta
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04728  Dopaminergic synapse
hsa05165  Human papillomavirus infection
Network
nt06114  PI3K signaling (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
Disease
H00773  Autosomal dominant mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5528 (PPP2R5D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    5528 (PPP2R5D)
   04151 PI3K-Akt signaling pathway
    5528 (PPP2R5D)
   04152 AMPK signaling pathway
    5528 (PPP2R5D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    5528 (PPP2R5D)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5528 (PPP2R5D)
  09156 Nervous system
   04728 Dopaminergic synapse
    5528 (PPP2R5D)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    5528 (PPP2R5D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5528 (PPP2R5D)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5528 (PPP2R5D)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5528 (PPP2R5D)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5528 (PPP2R5D)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     5528 (PPP2R5D)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5528 (PPP2R5D)
SSDB
Motif
Pfam: B56
Other DBs
NCBI-GeneID: 5528
NCBI-ProteinID: NP_006236
OMIM: 601646
HGNC: 9312
Ensembl: ENSG00000112640
Vega: OTTHUMG00000014716
Pharos: Q14738(Tbio)
UniProt: Q14738 A0A024RD11
LinkDB
Position
6p21.1
AA seq 602 aa
MPYKLKKEKEPPKVAKCTAKPSSSGKDGGGENTEEAQPQPQPQPQPQAQSQPPSSNKRPS
NSTPPPTQLSKIKYSGGPQIVKKERRQSSSRFNLSKNRELQKLPALKDSPTQEREELFIQ
KLRQCCVLFDFVSDPLSDLKFKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFSVNLF
RTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFV
LALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHNGIAEL
LEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFLEKESSLTEP
VIVGLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHFQVAE
RALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQKL
FDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPT
AEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQE
AL
NT seq 1809 nt   +upstreamnt  +downstreamnt
atgccctataaactgaaaaaggagaaggagccccccaaggttgccaaatgcacagccaag
cctagcagctcgggcaaggatggtggaggcgagaacactgaggaggcccagccgcagccc
cagccccagccccagccccaagcccagtctcagccaccgtcatccaacaagcgtcccagc
aatagcacgccgccccccacgcagctcagcaaaatcaagtactcaggggggccccagatt
gtcaagaaggagcgacggcaaagctcctcccgcttcaacctcagcaagaatcgggagctg
cagaagcttcctgccctgaaagattcgccaacccaggagcgggaggagctgtttatccag
aagctacgccagtgctgtgtcctctttgacttcgtgtcagacccactcagtgacctcaaa
ttcaaggaggtgaagcgggcaggactcaacgagatggtggagtacatcacccatagccgt
gatgttgtcactgaggccatttaccctgaggctgtcaccatgttttcagtgaacctcttc
cggacgctgccaccttcatcgaatcccacaggggctgagtttgacccagaggaagatgag
cccaccctggaagctgcttggccacatctccagctcgtgtatgagttcttcttacgtttc
cttgagtctcctgatttccagccaaacatagccaagaagtacatcgaccagaagtttgta
cttgctctcctagacctatttgacagtgaggatcctcgagagcgggacttcctcaagacc
attttgcatcgcatctatggcaagtttttggggctccgggcttatatccgtaggcagatc
aaccacatcttctacaggttcatctacgagacggagcatcacaacgggattgctgagctc
ctggagatcctgggcagcatcatcaatggctttgccctgccccttaaagaagagcacaag
atgttcctcatccgtgtcctacttccccttcacaaggtcaagtccctgagtgtctaccac
cctcagctggcatactgtgtggtacaattcctggagaaggagagcagtctgactgagccg
gtaattgtgggacttctcaagttttggcccaagacccacagccccaaggaggtgatgttc
ttgaatgagctggaggagattctggacgtcattgaaccttctgagttcagcaaagtgatg
gaacccctcttccgccagctggccaagtgtgtctctagcccccatttccaggtggcagag
cgtgctctctattactggaacaatgagtacatcatgagcctgataagtgacaatgctgcc
cgagtcctccccatcatgttccctgcactctacaggaactccaagagccactggaacaag
acaatccatggactgatctataatgccctgaagttgtttatggaaatgaatcagaagctg
tttgatgactgcacacaacaatacaaggcagagaagcagaagggccggttccgaatgaag
gaaagggaagagatgtggcaaaaaatcgaggagctggcccggcttaatccccagtatccc
atgttccgagcccctccaccactgccccctgtgtactcgatggagacagagacccccaca
gctgaggacatccagcttctgaagaggactgtggagactgaggctgttcagatgctaaaa
gacatcaagaaggagaaagtgctgctgcggaggaagtcggagctgccccaggacgtgtac
accatcaaggcactggaggcgcacaagcgggcggaagagttcctaactgccagccaggag
gctctctga

KEGG   Homo sapiens (human): 5529
Entry
5529              CDS       T01001                                 

Gene name
PPP2R5E, B56E, B56epsilon
Definition
(RefSeq) protein phosphatase 2 regulatory subunit B'epsilon
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04728  Dopaminergic synapse
hsa05165  Human papillomavirus infection
Network
nt06114  PI3K signaling (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5529 (PPP2R5E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    5529 (PPP2R5E)
   04151 PI3K-Akt signaling pathway
    5529 (PPP2R5E)
   04152 AMPK signaling pathway
    5529 (PPP2R5E)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    5529 (PPP2R5E)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5529 (PPP2R5E)
  09156 Nervous system
   04728 Dopaminergic synapse
    5529 (PPP2R5E)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    5529 (PPP2R5E)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5529 (PPP2R5E)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5529 (PPP2R5E)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5529 (PPP2R5E)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5529 (PPP2R5E)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     5529 (PPP2R5E)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5529 (PPP2R5E)
SSDB
Motif
Pfam: B56 Sec7_N SBF2
Other DBs
NCBI-GeneID: 5529
NCBI-ProteinID: NP_001269108
OMIM: 601647
HGNC: 9313
Ensembl: ENSG00000154001
Vega: OTTHUMG00000140341
Pharos: Q16537(Tbio)
UniProt: Q16537
LinkDB
Position
14q23.2
AA seq 467 aa
MSSAPTTPPSVDKVDGFSRKSVRKARQKRSQSSSQFRSQGKPIELTPLPLLKDVPSSEQP
ELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRGCLTEQTYPEVVRMVS
CNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQPSIAKKYIDQKF
VLQLLELFDSEDPRERDYLKTVLHRIYGKFLGLRAFIRKQINNIFLRFVYETEHFNGVAE
LLEILGSIINGFALPLKAEHKQFLVKVLIPLHTVRSLSLFHAQLAYCIVQFLEKDPSLTE
PVIRGLMKFWPKTCSQKEVMFLGELEEILDVIEPSQFVKIQEPLFKQIAKCVSSPHFQVA
ERALYYWNNEYIMSLIEENSNVILPIMFSSLYRISKEHWNPAIVALVYNVLKAFMEMNST
MFDELTATYKSDRQREKKKEKEREELWKKLEDLELKRGLRRDGIIPT
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcctcagcaccaactactcctccatcagtggataaagtagacggattttctcggaag
tccgtcagaaaagccagacagaagaggtcgcaaagttcctcacagtttaggtctcaaggc
aagcctattgagttaacacctctgccgctgctaaaagacgttccatcctcagagcagcct
gaactgttcctaaagaaacttcagcagtgctgtgtcatttttgacttcatggacacgcta
tctgatcttaaaatgaaagaatacaagcgctccactcttaatgaactggtggactacatt
acaataagcagaggctgtttgacagagcagacttaccctgaagtagttagaatggtatct
tgcaatatattcagaactctccctcctagtgacagcaatgaatttgatccagaagaagat
gaacctacccttgaggcatcgtggccacacttacagcttgtatatgaatttttcatacga
tttttggaaagccaagaattccaacccagcattgccaaaaaatatatagatcagaaattt
gtattacagcttctggagctatttgacagcgaagaccctcgggaacgggactacttaaaa
acagtcttacacagaatttatggcaagtttcttggtcttagagcatttatccgaaaacag
attaacaatatttttctaaggtttgtttatgaaacagaacacttcaatggtgtagctgaa
ctgctggaaatattaggaagtattatcaatggctttgctttacctcttaaggcagaacac
aaacagtttctggtgaaagtattgatccctttacacactgtcaggagcttatcactcttc
catgcacagctggcatattgtatagtacagtttctggagaaagatccttcactcacagaa
ccagttattagggggttaatgaaattttggcctaaaacatgtagtcaaaaagaggtcatg
ttccttggggaactggaagaaatattggatgtgattgaaccttcacaatttgttaaaatc
caagaacctttgtttaaacaaatcgccaagtgtgtatctagcccccattttcaggtggca
gaaagagcactctattattggaataatgaatacatcatgagtttgatagaagaaaactct
aacgtcatccttcccatcatgttttccagcctttataggatttcaaaagaacattggaat
ccggctattgtggcgttggtgtacaatgtgttgaaggcatttatggaaatgaacagcacc
atgtttgacgagctgacagccacatacaagtcagatcgtcagcgtgagaaaaagaaagaa
aaggagcgtgaagaattgtggaaaaaattggaggatctggagttaaagagaggtcttaga
cgtgatggaataattccaacttaa

DBGET integrated database retrieval system