KEGG   Homo sapiens (human): 55366
Entry
55366             CDS       T01001                                 
Symbol
LGR4, BNMD17, DPSL, GPR48
Name
(RefSeq) leucine rich repeat containing G protein-coupled receptor 4
  KO
K04309  leucine-rich repeat-containing G protein-coupled receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Disease
H01593  Osteoporosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    55366 (LGR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    55366 (LGR4)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   R-spondin
    55366 (LGR4)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 LRR_1 7tm_1 LRRNT LRR_6
Other DBs
NCBI-GeneID: 55366
NCBI-ProteinID: NP_060960
OMIM: 606666
HGNC: 13299
Ensembl: ENSG00000205213
Pharos: Q9BXB1(Tbio)
UniProt: Q9BXB1 Q59ER8
Structure
LinkDB
Position
11:complement(27365961..27472790)
AA seq 951 aa
MPGPLGLLCFLALGLLGSAGPSGAAPPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQ
ALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTV
PSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQ
ALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEF
PQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHS
LVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPS
FNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDV
SFNELTSFPTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCDSYA
NLNTEDNSLQDHSVAQEKGTADAANVTSTLENEEHSQIIIHCTPSTGAFKPCEYLLGSWM
IRLTVWFIFLVALFFNLLVILTTFASCTSLPSSKLFIGLISVSNLFMGIYTGILTFLDAV
SWGRFAEFGIWWETGSGCKVAGFLAVFSSESAIFLLMLATVERSLSAKDIMKNGKSNHLK
QFRVAALLAFLGATVAGCFPLFHRGEYSASPLCLPFPTGETPSLGFTVTLVLLNSLAFLL
MAVIYTKLYCNLEKEDLSENSQSSMIKHVAWLIFTNCIFFCPVAFFSFAPLITAISISPE
IMKSVTLIFFPLPACLNPVLYVFFNPKFKEDWKLLKRRVTKKSGSVSVSISSQGGCLEQD
FYYDCGMYSHLQGNLTVCDCCESFLLTKPVSCKHLIKSHSCPALAVASCQRPEGYWSDCG
TQSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVKD
NT seq 2856 nt   +upstreamnt  +downstreamnt
atgccgggcccgctagggctgctctgcttcctcgccctggggctgctcggctcggccggg
cccagcggcgcggcgccgcctctctgcgcggcgccctgcagctgcgacggcgaccgtcgg
gtggactgctccgggaaggggctgacggccgtgcccgaggggctcagcgccttcacccaa
gcgctggatatcagtatgaacaacattactcagttgccagaagatgcatttaagaacttt
ccttttctagaagagctacaattggcgggcaacgacctttcttttatccacccaaaggcc
ttgtctgggttgaaagaactcaaagttctaacgctccagaataatcagttgaaaacagta
cccagtgaagccattcgagggctgagtgctttgcagtctttgcgtttagatgccaaccat
attacctcagtccccgaggacagttttgaaggacttgttcagttacggcatctgtggctg
gatgacaacagcttgacggaggtgcctgtgcaccccctcagcaatctgcccaccctacag
gcgctgaccctggctctcaacaagatctcaagcatccctgactttgcatttaccaacctt
tcaagcctggtagttctgcatcttcataacaataaaattagaagcctgagtcaacactgt
tttgatggactagataacctggagaccttagacttgaattataataacttgggggaattt
cctcaggctattaaagcccttcctagccttaaagagctaggatttcatagtaattctatt
tctgttatccctgatggagcatttgatggtaatccactcttaagaactatacatttgtat
gataatcctctgtcttttgtggggaactcagcatttcacaatttatctgatcttcattcc
ctagtcattcgtggtgcaagcatggtgcagcagttccccaatcttacaggaactgtccac
ctggaaagtctgactttgacaggtacaaagataagcagcatacctaataatttgtgtcaa
gaacaaaagatgcttaggactttggacttgtcttacaataatataagagaccttccaagt
tttaatggttgccatgctctggaagaaatttctttacagcgtaatcaaatctaccaaata
aaggaaggcacctttcaaggcctgatatctctaaggattctagatctgagtagaaacctg
atacatgaaattcacagtagagcttttgccacacttgggccaataactaacctagatgta
agtttcaatgaattaacttcctttcctacggaaggcctgaatgggctaaatcaactgaaa
cttgtgggcaacttcaagctgaaagaagccttagcagcaaaagactttgttaacctcagg
tctttatcagtaccatatgcttatcagtgctgtgcattttggggttgtgactcttatgca
aatttaaacacagaagataacagcctccaggaccacagtgtggcacaggagaaaggtact
gctgatgcagcaaatgtcacaagcactcttgaaaatgaagaacatagtcaaataattatc
cattgtacaccttcaacaggtgcttttaagccctgtgaatatttactgggaagctggatg
attcgtcttactgtgtggttcattttcttggttgcattatttttcaacctgcttgttatt
ttaacaacatttgcatcttgtacatcactgccttcgtccaaattgtttataggcttgatt
tctgtgtctaacttattcatgggaatctatactggcatcctaacttttcttgatgctgtg
tcctggggcagattcgctgaatttggcatttggtgggaaactggcagtggctgcaaagta
gctgggtttcttgcagttttctcctcagaaagtgccatatttttattaatgctagcaact
gtcgaaagaagcttatctgcaaaagatataatgaaaaatgggaagagcaatcatctcaaa
cagttccgggttgctgcccttttggctttcctaggtgctacagtagcaggctgttttccc
cttttccatagaggggaatattctgcatcacccctttgtttgccatttcctacaggtgaa
acgccatcattaggattcactgtaacgttagtgctattaaactcactagcatttttatta
atggccgttatctacactaaactatactgcaacttggaaaaagaggacctctcagaaaac
tcacaatctagcatgattaagcatgtcgcttggctaatcttcaccaattgcatctttttc
tgccctgtggcgtttttttcatttgcaccattgatcactgcaatctctatcagccccgaa
ataatgaagtctgttactctgatattttttccattgcctgcttgcctgaatccagtcctg
tatgttttcttcaacccaaagtttaaagaagactggaagttactgaagcgacgtgttacc
aagaaaagtggatcagtttcagtttccatcagtagccaaggtggttgtctggaacaggat
ttctactacgactgtggcatgtactcacatttgcagggcaacctgactgtttgcgactgc
tgcgaatcgtttcttttaacaaagccagtatcatgcaaacacttgataaaatcacacagc
tgtcctgcattggcagtggcttcttgccaaagacctgagggctactggtccgactgtggc
acacagtcggcccactctgattatgcagatgaagaagattcctttgtctcagacagttct
gaccaggtgcaggcctgtggacgagcctgcttctaccagagtagaggattccctttggtg
cgctatgcttacaatctaccaagagttaaagactga

KEGG   Homo sapiens (human): 59352
Entry
59352             CDS       T01001                                 
Symbol
LGR6, GPCR, VTS20631
Name
(RefSeq) leucine rich repeat containing G protein-coupled receptor 6
  KO
K08399  leucine-rich repeat-containing G protein-coupled receptor 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    59352 (LGR6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    59352 (LGR6)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   R-spondin
    59352 (LGR6)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 LRRNT 7tm_1
Other DBs
NCBI-GeneID: 59352
NCBI-ProteinID: NP_001017403
OMIM: 606653
HGNC: 19719
Ensembl: ENSG00000133067
Pharos: Q9HBX8(Tbio)
UniProt: Q9HBX8
LinkDB
Position
1:202193799..202319761
AA seq 967 aa
MPSPPGLRALWLCAALCASRRAGGAPQPGPGPTACPAPCHCQEDGIMLSADCSELGLSAV
PGDLDPLTAYLDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPGQAFSGLYSLKILM
LQNNQLGGIPAEALWELPSLQSLRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPVR
ALNNLPALQAMTLALNRISHIPDYAFQNLTSLVVLHLHNNRIQHLGTHSFEGLHNLETLD
LNYNKLQEFPVAIRTLGRLQELGFHNNNIKAIPEKAFMGNPLLQTIHFYDNPIQFVGRSA
FQYLPKLHTLSLNGAMDIQEFPDLKGTTSLEILTLTRAGIRLLPSGMCQQLPRLRVLELS
HNQIEELPSLHRCQKLEEIGLQHNRIWEIGADTFSQLSSLQALDLSWNAIRSIHPEAFST
LHSLVKLDLTDNQLTTLPLAGLGGLMHLKLKGNLALSQAFSKDSFPKLRILEVPYAYQCC
PYGMCASFFKASGQWEAEDLHLDDEESSKRPLGLLARQAENHYDQDLDELQLEMEDSKPH
PSVQCSPTPGPFKPCEYLFESWGIRLAVWAIVLLSVLCNGLVLLTVFAGGPVPLPPVKFV
VGAIAGANTLTGISCGLLASVDALTFGQFSEYGARWETGLGCRATGFLAVLGSEASVLLL
TLAAVQCSVSVSCVRAYGKSPSLGSVRAGVLGCLALAGLAAALPLASVGEYGASPLCLPY
APPEGQPAALGFTVALVMMNSFCFLVVAGAYIKLYCDLPRGDFEAVWDCAMVRHVAWLIF
ADGLLYCPVAFLSFASMLGLFPVTPEAVKSVLLVVLPLPACLNPLLYLLFNPHFRDDLRR
LRPRAGDSGPLAYAAAGELEKSSCDSTQALVAFSDVDLILEASEAGRPPGLETYGFPSVT
LISCQQPGAPRLEGSHCVEPEGNHFGNPQPSMDGELLLRAEGSTPAGGGLSGGGGFQPSG
LAFASHV
NT seq 2904 nt   +upstreamnt  +downstreamnt
atgcccagcccgccggggctccgggcgctatggctttgcgccgcgctgtgcgcttcccgg
agggccggcggcgccccccagcccggcccggggcccaccgcctgcccggccccctgccac
tgccaggaggacggcatcatgctgtctgccgactgctctgagctcgggctgtccgccgtt
ccgggggacctggaccccctgacggcttacctggacctcagcatgaacaacctcacagag
cttcagcctggcctcttccaccacctgcgcttcttggaggagctgcgtctctctgggaac
catctctcacacatcccaggacaagcattctctggtctctacagcctgaaaatcctgatg
ctgcagaacaatcagctgggaggaatccccgcagaggcgctgtgggagctgccgagcctg
cagtcgctgcgcctagatgccaacctcatctccctggtcccggagaggagctttgagggg
ctgtcctccctccgccacctctggctggacgacaatgcactcacggagatccctgtcagg
gccctcaacaacctccctgccctgcaggccatgaccctggccctcaaccgcatcagccac
atccccgactacgcgttccagaatctcaccagccttgtggtgctgcatttgcataacaac
cgcatccagcatctggggacccacagcttcgaggggctgcacaatctggagacactagac
ctgaattataacaagctgcaggagttccctgtggccatccggaccctgggcagactgcag
gaactggggttccataacaacaacatcaaggccatcccagaaaaggccttcatggggaac
cctctgctacagacgatacacttttatgataacccaatccagtttgtgggaagatcggca
ttccagtacctgcctaaactccacacactatctctgaatggtgccatggacatccaggag
tttccagatctcaaaggcaccaccagcctggagatcctgaccctgacccgcgcaggcatc
cggctgctcccatcggggatgtgccaacagctgcccaggctccgagtcctggaactgtct
cacaatcaaattgaggagctgcccagcctgcacaggtgtcagaaattggaggaaatcggc
ctccaacacaaccgcatctgggaaattggagctgacaccttcagccagctgagctccctg
caagccctggatcttagctggaacgccatccggtccatccaccccgaggccttctccacc
ctgcactccctggtcaagctggacctgacagacaaccagctgaccacactgcccctggct
ggacttgggggcttgatgcatctgaagctcaaagggaaccttgctctctcccaggccttc
tccaaggacagtttcccaaaactgaggatcctggaggtgccttatgcctaccagtgctgt
ccctatgggatgtgtgccagcttcttcaaggcctctgggcagtgggaggctgaagacctt
caccttgatgatgaggagtcttcaaaaaggcccctgggcctccttgccagacaagcagag
aaccactatgaccaggacctggatgagctccagctggagatggaggactcaaagccacac
cccagtgtccagtgtagccctactccaggccccttcaagccctgtgagtacctctttgaa
agctggggcatccgcctggccgtgtgggccatcgtgttgctctccgtgctctgcaatgga
ctggtgctgctgaccgtgttcgctggcgggcctgtccccctgcccccggtcaagtttgtg
gtaggtgcgattgcaggcgccaacaccttgactggcatttcctgtggccttctagcctca
gtcgatgccctgacctttggtcagttctctgagtacggagcccgctgggagacggggcta
ggctgccgggccactggcttcctggcagtacttgggtcggaggcatcggtgctgctgctc
actctggccgcagtgcagtgcagcgtctccgtctcctgtgtccgggcctatgggaagtcc
ccctccctgggcagcgttcgagcaggggtcctaggctgcctggcactggcagggctggcc
gccgcgctgcccctggcctcagtgggagaatacggggcctccccactctgcctgccctac
gcgccacctgagggtcagccagcagccctgggcttcaccgtggccctggtgatgatgaac
tccttctgtttcctggtcgtggccggtgcctacatcaaactgtactgtgacctgccgcgg
ggcgactttgaggccgtgtgggactgcgccatggtgaggcacgtggcctggctcatcttc
gcagacgggctcctctactgtcccgtggccttcctcagctttgcctccatgctgggcctc
ttccctgtcacgcccgaggccgtcaagtctgtcctgctggtggtgctgcccctgcctgcc
tgcctcaacccactgctgtacctgctcttcaacccccacttccgggatgaccttcggcgg
cttcggccccgcgcaggggactcagggcccctagcctatgctgcggccggggagctggag
aagagctcctgtgattctacccaggccctggtagccttctctgatgtggatctcattctg
gaagcttctgaagctgggcggccccctgggctggagacctatggcttcccctcagtgacc
ctcatctcctgtcagcagccaggggcccccaggctggagggcagccattgtgtagagcca
gaggggaaccactttgggaacccccaaccctccatggatggagaactgctgctgagggca
gagggatctacgccagcaggtggaggcttgtcagggggtggcggctttcagccctctggc
ttggcctttgcttcacacgtgtaa

KEGG   Homo sapiens (human): 8549
Entry
8549              CDS       T01001                                 
Symbol
LGR5, FEX, GPR49, GPR67, GRP49, HG38
Name
(RefSeq) leucine rich repeat containing G protein-coupled receptor 5
  KO
K04308  leucine-rich repeat-containing G protein-coupled receptor 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    8549 (LGR5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    8549 (LGR5)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   R-spondin
    8549 (LGR5)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 7tm_1 LRRNT
Other DBs
NCBI-GeneID: 8549
NCBI-ProteinID: NP_003658
OMIM: 606667
HGNC: 4504
Ensembl: ENSG00000139292
Pharos: O75473(Tbio)
UniProt: O75473 A0A0A8K8C7
Structure
LinkDB
Position
12:71439129..71586310
AA seq 907 aa
MDTSRLGVLLSLPVLLQLATGGSSPRSGVLLRGCPTHCHCEPDGRMLLRVDCSDLGLSEL
PSNLSVFTSYLDLSMNNISQLLPNPLPSLRFLEELRLAGNALTYIPKGAFTGLYSLKVLM
LQNNQLRHVPTEALQNLRSLQSLRLDANHISYVPPSCFSGLHSLRHLWLDDNALTEIPVQ
AFRSLSALQAMTLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLD
LNYNNLDEFPTAIRTLSNLKELGFHSNNIRSIPEKAFVGNPSLITIHFYDNPIQFVGRSA
FQHLPELRTLTLNGASQITEFPDLTGTANLESLTLTGAQISSLPQTVCNQLPNLQVLDLS
YNLLEDLPSFSVCQKLQKIDLRHNEIYEIKVDTFQQLLSLRSLNLAWNKIAIIHPNAFST
LPSLIKLDLSSNLLSSFPITGLHGLTHLKLTGNHALQSLISSENFPELKVIEMPYAYQCC
AFGVCENAYKISNQWNKGDNSSMDDLHKKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQ
CSPSPGPFKPCEHLLDGWLIRIGVWTIAVLALTCNALVTSTVFRSPLYISPIKLLIGVIA
AVNMLTGVSSAVLAGVDAFTFGSFARHGAWWENGVGCHVIGFLSIFASESSVFLLTLAAL
ERGFSVKYSAKFETKAPFSSLKVIILLCALLALTMAAVPLLGGSKYGASPLCLPLPFGEP
STMGYMVALILLNSLCFLMMTIAYTKLYCNLDKGDLENIWDCSMVKHIALLLFTNCILNC
PVAFLSFSSLINLTFISPEVIKFILLVVVPLPACLNPLLYILFNPHFKEDLVSLRKQTYV
WTRSKHPSLMSINSDDVEKQSCDSTQALVTFTSSSITYDLPPSSVPSPAYPVTESCHLSS
VAFVPCL
NT seq 2724 nt   +upstreamnt  +downstreamnt
atggacacctcccggctcggtgtgctcctgtccttgcctgtgctgctgcagctggcgacc
gggggcagctctcccaggtctggtgtgttgctgaggggctgccccacacactgtcattgc
gagcccgacggcaggatgttgctcagggtggactgctccgacctggggctctcggagctg
ccttccaacctcagcgtcttcacctcctacctagacctcagtatgaacaacatcagtcag
ctgctcccgaatcccctgcccagtctccgcttcctggaggagttacgtcttgcgggaaac
gctctgacatacattcccaagggagcattcactggcctttacagtcttaaagttcttatg
ctgcagaataatcagctaagacacgtacccacagaagctctgcagaatttgcgaagcctt
caatccctgcgtctggatgctaaccacatcagctatgtgcccccaagctgtttcagtggc
ctgcattccctgaggcacctgtggctggatgacaatgcgttaacagaaatccccgtccag
gcttttagaagtttatcggcattgcaagccatgaccttggccctgaacaaaatacaccac
ataccagactatgcctttggaaacctctccagcttggtagttctacatctccataacaat
agaatccactccctgggaaagaaatgctttgatgggctccacagcctagagactttagat
ttaaattacaataaccttgatgaattccccactgcaattaggacactctccaaccttaaa
gaactaggatttcatagcaacaatatcaggtcgatacctgagaaagcatttgtaggcaac
ccttctcttattacaatacatttctatgacaatcccatccagtttgttgggagatctgct
tttcaacatttacctgaactaagaacactgactctgaatggtgcctcacaaataactgaa
tttcctgatttaactggaactgcaaacctggagagtctgactttaactggagcacagatc
tcatctcttcctcaaaccgtctgcaatcagttacctaatctccaagtgctagatctgtct
tacaacctattagaagatttacccagtttttcagtctgccaaaagcttcagaaaattgac
ctaagacataatgaaatctacgaaattaaagttgacactttccagcagttgcttagcctc
cgatcgctgaatttggcttggaacaaaattgctattattcaccccaatgcattttccact
ttgccatccctaataaagctggacctatcgtccaacctcctgtcgtcttttcctataact
gggttacatggtttaactcacttaaaattaacaggaaatcatgccttacagagcttgata
tcatctgaaaactttccagaactcaaggttatagaaatgccttatgcttaccagtgctgt
gcatttggagtgtgtgagaatgcctataagatttctaatcaatggaataaaggtgacaac
agcagtatggacgaccttcataagaaagatgctggaatgtttcaggctcaagatgaacgt
gaccttgaagatttcctgcttgactttgaggaagacctgaaagcccttcattcagtgcag
tgttcaccttccccaggccccttcaaaccctgtgaacacctgcttgatggctggctgatc
agaattggagtgtggaccatagcagttctggcacttacttgtaatgctttggtgacttca
acagttttcagatcccctctgtacatttcccccattaaactgttaattggggtcatcgca
gcagtgaacatgctcacgggagtctccagtgccgtgctggctggtgtggatgcgttcact
tttggcagctttgcacgacatggtgcctggtgggagaatggggttggttgccatgtcatt
ggttttttgtccatttttgcttcagaatcatctgttttcctgcttactctggcagccctg
gagcgtgggttctctgtgaaatattctgcaaaatttgaaacgaaagctccattttctagc
ctgaaagtaatcattttgctctgtgccctgctggccttgaccatggccgcagttcccctg
ctgggtggcagcaagtatggcgcctcccctctctgcctgcctttgccttttggggagccc
agcaccatgggctacatggtcgctctcatcttgctcaattccctttgcttcctcatgatg
accattgcctacaccaagctctactgcaatttggacaagggagacctggagaatatttgg
gactgctctatggtaaaacacattgccctgttgctcttcaccaactgcatcctaaactgc
cctgtggctttcttgtccttctcctctttaataaaccttacatttatcagtcctgaagta
attaagtttatccttctggtggtagtcccacttcctgcatgtctcaatccccttctctac
atcttgttcaatcctcactttaaggaggatctggtgagcctgagaaagcaaacctacgtc
tggacaagatcaaaacacccaagcttgatgtcaattaactctgatgatgtcgaaaaacag
tcctgtgactcaactcaagccttggtaacctttaccagctccagcatcacttatgacctg
cctcccagttccgtgccatcaccagcttatccagtgactgagagctgccatctttcctct
gtggcatttgtcccatgtctctaa

DBGET integrated database retrieval system