KEGG   Homo sapiens (human): 55680
Entry
55680             CDS       T01001                                 
Symbol
RUFY2, RABIP4R, ZFYVE13
Name
(RefSeq) RUN and FYVE domain containing 2
  KO
K12482  RUN and FYVE domain-containing protein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    55680 (RUFY2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55680 (RUFY2)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab4 associated proteins
    55680 (RUFY2)
SSDB
Motif
Pfam: RUN FYVE Trimer_CC YabA DUF724 bZIP_1 ADK_lid Baculo_IE-1 zf-RING_5 IBR zf_C2HC_14
Other DBs
NCBI-GeneID: 55680
NCBI-ProteinID: NP_001317032
OMIM: 610328
HGNC: 19761
Ensembl: ENSG00000204130
Vega: OTTHUMG00000018353
Pharos: Q8WXA3(Tdark)
UniProt: Q8WXA3 Q5GIA6
LinkDB
Position
10:complement(68341112..68407277)
AA seq 606 aa
MATKDPTAVERANLLNMAKLSIKGLIESALSFGRTLDSDYPPLQQFFVVMEHCLKHGLKV
RKSFLSYNKTIWGPLELVEKLYPEAEEIGASVRDLPGLKTPLGRARAWLRLALMQKKMAD
YLRCLIIQRDLLSEFYEYHALMMEEEGAVIVGLLVGLNVIDANLCVKGEDLDSQVGVIDF
SMYLKNEEDIGNKERNVQIAAILDQKNYVEELNRQLNSTVSSLHSRVDSLEKSNTKLIEE
LAIAKNNIIKLQEENHQLRSENKLILMKTQQHLEVTKVDVETELQTYKHSRQGLDEMYNE
ARRQLRDESQLRQDVENELAVQVSMKHEIELAMKLLEKDIHEKQDTLIGLRQQLEEVKAI
NIEMYQKLQGSEDGLKEKNEIIARLEEKTNKITAAMRQLEQRLQQAEKAQMEAEDEDEKY
LQECLSKSDSLQKQISQKEKQLVQLETDLKIEKEWRQTLQEDLQKEKDALSHLRNETQQI
ISLKKEFLNLQDENQQLKKIYHEQEQALQELGNKLSESKLKIEDIKEANKALQGLVWLKD
KEATHCKLCEKEFSLSKRKHHCRNCGEIFCNACSDNELPLPSSPKPVRVCDSCHALLIQR
CSSNLP
NT seq 1821 nt   +upstreamnt  +downstreamnt
atggctacaaaagaccccacagctgtagagagagcaaacttgttaaacatggctaaactg
agtatcaaaggactcattgaatctgctctgagctttggccgcactttggattctgactat
ccccccttgcagcaattctttgttgttatggaacattgcctgaaacacggtcttaaagta
agaaaatcatttttgagttacaacaaaaccatctggggccctttggaactggtggagaag
ctgtaccccgaagcagaggaaataggagctagtgtccgggatctacctggtctgaagacc
cctctgggtcgagcaagagcgtggcttcgattagccctcatgcaaaaaaaaatggccgat
tacttacgttgcttaattattcagagggatctcttgagtgagttttatgagtatcacgca
ctaatgatggaagaagaaggagcagtaattgttgggctgctggttggcctgaatgtgatc
gatgctaatctgtgtgtgaagggagaggatttagactcacaagttggagtgattgatttt
tctatgtatttaaagaatgaagaagatattggaaataaagaaaggaatgttcaaattgct
gccatattagaccaaaagaattatgttgaagaattaaatagacaactgaacagcacagtc
agcagcctccattcaagagttgattcattagaaaagtcaaatactaagctgattgaagag
ttagcaatagcaaagaataacatcattaaactccaggaagaaaatcatcaattacgaagt
gaaaataaattgattttaatgaaaacacagcagcacctagaggttaccaaagtagatgtg
gaaactgagcttcaaacatataagcattctcgtcaggggctagatgaaatgtacaatgaa
gccagaaggcagcttcgagatgaatctcagttacgacaggatgtagagaatgagctagca
gtacaagttagtatgaagcatgagattgaacttgccatgaagttgctggagaaagatatc
catgagaaacaagatactctgataggccttcgacaacaactagaggaagttaaagcaatt
aacatagagatgtatcaaaagttgcagggttctgaagatggcttgaaagaaaaaaatgaa
ataattgcccgactagaagaaaaaaccaataaaattactgcagccatgaggcagctggaa
caaagattgcagcaagcagagaaggcgcaaatggaagctgaagatgaggatgagaaatat
ctacaagaatgtctcagtaaatctgatagtctgcagaaacaaatctcccaaaaggagaaa
cagctggtgcaactggaaactgacttgaagattgagaaggaatggaggcagactttgcag
gaagatcttcaaaaggagaaagatgccttatctcatcttagaaatgagactcaacaaatc
attagtcttaaaaaagagttccttaacctccaggatgaaaatcagcagttgaaaaaaata
tatcatgaacaagagcaagctcttcaagaactcggcaacaagcttagcgaatcaaaactt
aaaattgaagacataaaagaagccaacaaagcattgcagggactggtttggctgaaagac
aaagaagcaacacattgtaaactttgtgaaaaggaattctcactctctaagagaaagcac
cactgtagaaattgtggggaaattttctgtaatgcctgctctgacaacgaactacctttg
ccttcttcaccaaaaccagtacgggtttgtgattcctgtcatgcactgctcattcagaga
tgctcatctaacttgccctga

KEGG   Homo sapiens (human): 80230
Entry
80230             CDS       T01001                                 
Symbol
RUFY1, RABIP4, ZFYVE12
Name
(RefSeq) RUN and FYVE domain containing 1
  KO
K12482  RUN and FYVE domain-containing protein 1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    80230 (RUFY1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    80230 (RUFY1)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab4 associated proteins
    80230 (RUFY1)
SSDB
Motif
Pfam: RUN FYVE zf-RING_5 IBR Baculo_IE-1 HypA
Other DBs
NCBI-GeneID: 80230
NCBI-ProteinID: NP_079434
OMIM: 610327
HGNC: 19760
Ensembl: ENSG00000176783
Vega: OTTHUMG00000130913
Pharos: Q96T51(Tbio)
UniProt: Q96T51
Structure
LinkDB
Position
5:179550554..179610012
AA seq 708 aa
MADREGGCAAGRGRELEPELEPGPGPGSALEPGEEFEIVDRSQLPGPGDLRSATRPRAAE
GWSAPILTLARRATGNLSASCGSALRAAAGLGGGDSGDGTARAASKCQMMEERANLMHMM
KLSIKVLLQSALSLGRSLDADHAPLQQFFVVMEHCLKHGLKVKKSFIGQNKSFFGPLELV
EKLCPEASDIATSVRNLPELKTAVGRGRAWLYLALMQKKLADYLKVLIDNKHLLSEFYEP
EALMMEEEGMVIVGLLVGLNVLDANLCLKGEDLDSQVGVIDFSLYLKDVQDLDGGKEHER
ITDVLDQKNYVEELNRHLSCTVGDLQTKIDGLEKTNSKLQEELSAATDRICSLQEEQQQL
REQNELIRERSEKSVEITKQDTKVELETYKQTRQGLDEMYSDVWKQLKEEKKVRLELEKE
LELQIGMKTEMEIAMKLLEKDTHEKQDTLVALRQQLEEVKAINLQMFHKAQNAESSLQQK
NEAITSFEGKTNQVMSSMKQMEERLQHSERARQGAEERSHKLQQELGGRIGALQLQLSQL
HEQCSSLEKELKSEKEQRQALQRELQHEKDTSSLLRMELQQVEGLKKELRELQDEKAELQ
KICEEQEQALQEMGLHLSQSKLKMEDIKEVNQALKGHAWLKDDEATHCRQCEKEFSISRR
KHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLLLQRCSSTAS
NT seq 2127 nt   +upstreamnt  +downstreamnt
atggccgaccgggaaggcggctgcgctgctgggcgggggcgggagctggagccggagctg
gagccggggccggggcccgggtcagcgcttgagccgggagaagagtttgagatcgtggac
cgaagccagctgcccggcccaggcgacctgcggagcgcaacgaggccgcgggcggccgag
ggctggtcggcgcccatcctgaccctggcacgcagggccaccgggaacctgtcggcgagc
tgcgggagcgcgctgcgcgcggccgcggggctgggcggcggggacagcggggacggcacg
gcgcgcgcagcttctaagtgccagatgatggaggagcgtgccaacctgatgcacatgatg
aaactcagcatcaaggtgttgctccagtcggctctgagcctgggccgcagcctggatgcg
gaccatgcccccttgcagcagttctttgtagtgatggagcactgcctcaaacatgggctg
aaagttaagaagagttttattggccaaaataaatcattctttggtcctttggagctggtg
gagaaactttgtccagaagcatcagatatagcgactagtgtcagaaatcttccagaatta
aagacagctgtgggaagaggccgagcgtggctttatcttgcactcatgcaaaagaaactg
gcagattatctgaaagtgcttatagacaataaacatctcttaagcgagttctatgagcct
gaggctttaatgatggaggaagaagggatggtgattgttggtctgctggtgggactcaat
gttctcgatgccaatctctgcttgaaaggagaagacttggattctcaggttggagtaata
gatttttccctctaccttaaggatgtgcaggatcttgatggtggcaaggagcatgaaaga
attactgatgtccttgatcaaaaaaattatgtggaagaacttaaccggcacttgagctgc
acagttggggatcttcaaaccaagatagatggcttggaaaagactaactcaaagcttcaa
gaagagctttcagctgcaacagaccgaatttgctcacttcaagaagaacagcagcagtta
agagaacaaaatgaattaattcgagaaagaagtgaaaagagtgtagagataacaaaacag
gataccaaagttgagctggagacttacaagcaaactcggcaaggtctggatgaaatgtac
agtgatgtgtggaagcagctaaaagaggagaagaaagtccggttggaactggaaaaagaa
ctggagttacaaattggaatgaaaaccgaaatggaaattgcaatgaagttactggaaaag
gacacccacgagaagcaggacacactagttgccctccgccagcagctggaagaagtcaaa
gcgattaatttacagatgtttcacaaagctcagaatgcagagagcagtttgcagcagaag
aatgaagccatcacatcctttgaaggaaaaaccaaccaagttatgtccagcatgaaacaa
atggaagaaaggttgcagcactcggagcgggcgaggcagggggctgaggagcggagccac
aagctgcagcaggagctgggcgggaggatcggcgccctgcagctgcagctctcccagctg
cacgagcaatgctcaagcctggagaaagaattgaaatcagaaaaagagcaaagacaggct
cttcagcgcgaattacagcacgagaaagacacttcctctctactcaggatggagctgcaa
caagtggaaggactgaaaaaggagttgcgggagcttcaggacgagaaggcagagctgcag
aagatctgcgaggagcaggaacaagccctccaggaaatgggcctgcacctcagccagtcc
aagctgaagatggaagatataaaagaagtgaaccaggcactgaagggccacgcctggctg
aaagatgacgaagcgacacactgtaggcagtgtgagaaggagttctccatttcccggaga
aagcaccactgccggaactgtggccacatcttctgcaacacctgctccagcaacgagctg
gccctgccctcctaccccaagccggtgcgagtgtgcgacagctgccacaccctgctcctg
cagcgctgctcctccacggcctcctga

DBGET integrated database retrieval system