KEGG   Homo sapiens (human): 55829
Entry
55829             CDS       T01001                                 
Symbol
SELENOS, AD-015, ADO15, SBBI8, SELS, SEPS1, VIMP
Name
(RefSeq) selenoprotein S
  KO
K14025  selenoprotein S
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    55829 (SELENOS)
SSDB
Motif
Pfam: Selenoprotein_S LCD1 DUF3526 Aconitase DNA_primase_lrg
Other DBs
NCBI-GeneID: 55829
NCBI-ProteinID: NP_060915
OMIM: 607918
HGNC: 30396
Ensembl: ENSG00000131871
Vega: OTTHUMG00000166441
Pharos: Q9BQE4(Tbio)
UniProt: Q9BQE4
Structure
LinkDB
Position
15:complement(101270809..101277485)
AA seq 189 aa
MERQEESLSARPALETEGLRFLHTTVGSLLATYGWYIVFSCILLYVVFQKLSARLRALRQ
RQLDRAAAAVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWD
SMQEGKSYKGNAKKPQEEDSPGPSTSSVLKRKSDRKPLRGGGYNPLSGEGGGACSWRPGR
RGPSSGGUG
NT seq 570 nt   +upstreamnt  +downstreamnt
atggaacgccaagaggagtctctgtccgcgcggccggccctggagaccgaggggctgcgc
ttcctgcacaccacggtgggctccctgctggccacctatggctggtacatcgtcttcagc
tgcatccttctctacgtggtctttcagaagctttccgcccggctaagagccttgaggcag
aggcagctggaccgagctgcggctgctgtggaacctgatgttgttgttaaacgacaagaa
gctttagcagctgctcgactgaaaatgcaagaagaactaaatgcgcaagttgaaaagcat
aaggaaaaactgaaacaacttgaagaagaaaaaaggagacagaagattgaaatgtgggac
agcatgcaagaaggaaaaagttacaaaggaaatgcaaagaagccccaggaggaagacagt
cctgggccttccacttcatctgtcctgaaacggaaatcggacagaaagcctttgcgggga
ggaggttataacccgttgtctggtgaaggaggcggagcttgctcctggagacctggacgc
agaggcccgtcatctggcggatgaggctaa

DBGET integrated database retrieval system