KEGG   Homo sapiens (human): 56259
Entry
56259             CDS       T01001                                 
Symbol
CTNNBL1, C20orf33, IMD99, NAP, P14L, PP8304, dJ633O20.1
Name
(RefSeq) catenin beta like 1
  KO
K12864  beta-catenin-like protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    56259 (CTNNBL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    56259 (CTNNBL1)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19 complex
    56259 (CTNNBL1)
 Complex C
   Prp19-CDC5 complex
    56259 (CTNNBL1)
SSDB
Motif
Pfam: CTNNBL Arm
Other DBs
NCBI-GeneID: 56259
NCBI-ProteinID: NP_110517
OMIM: 611537
HGNC: 15879
Ensembl: ENSG00000132792
Pharos: Q8WYA6(Tbio)
UniProt: Q8WYA6
Structure
LinkDB
Position
20:37694030..37872118
AA seq 563 aa
MDVGELLSYQPNRGTKRPRDDEEEEQKMRRKQTGTRERGRYREEEMTVVEEADDDKKRLL
QIIDRDGEEEEEEEEPLDESSVKKMILTFEKRSYKNQELRIKFPDNPEKFMESELDLNDI
IQEMHVVATMPDLYHLLVELNAVQSLLGLLGHDNTDVSIAVVDLLQELTDIDTLHESEEG
AEVLIDALVDGQVVALLVQNLERLDESVKEEADGVHNTLAIVENMAEFRPEMCTEGAQQG
LLQWLLKRLKAKMPFDANKLYCSEVLAILLQDNDENRELLGELDGIDVLLQQLSVFKRHN
PSTAEEQEMMENLFDSLCSCLMLSSNRERFLKGEGLQLMNLMLREKKISRSSALKVLDHA
MIGPEGTDNCHKFVDILGLRTIFPLFMKSPRKIKKVGTTEKEHEEHVCSILASLLRNLRG
QQRTRLLNKFTENDSEKVDRLMELHFKYLGAMQVADKKIEGEKHDMVRRGEIIDNDTEEE
FYLRRLDAGLFVLQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENI
GDGRSPEFRENEQKRILGLLENF
NT seq 1692 nt   +upstreamnt  +downstreamnt
atggacgtgggcgaacttctgagctaccagcccaataggggcacaaaacgtccccgggat
gatgaagaggaggagcagaagatgcgtcggaaacaaactggtactcgagaacgcggccgc
tatcgggaagaagaaatgactgtggtggaggaagcggatgatgacaaaaaaaggctgctg
cagattattgacagagatggggaagaggaagaggaagaggaggagccattggatgaaagc
tcagtgaagaaaatgatcctcacatttgaaaagagatcatataaaaaccaagaattgcgg
attaagtttccagacaatccagagaagttcatggaatccgagctggacctaaatgacatc
attcaggagatgcacgtggtggccaccatgccagacctgtaccaccttctggtggagctg
aatgctgtacagtcgcttctcggcttgctcggacacgataatacagatgtgtccatagct
gtggtcgatttgcttcaggaattaacagatatagacaccctccatgagagtgaagaggga
gcagaagtgctcatcgatgctctggtggatgggcaggtggtagcactgctggtacagaat
ctggagcgcctggatgagtctgtgaaagaggaggcagatggcgtccacaacactctggct
attgtggaaaacatggctgagttccggcctgagatgtgtacagagggtgcccagcagggt
cttctacagtggctgttgaagaggctgaaggcaaagatgccttttgatgccaacaaactg
tattgcagtgaagtgctggccatattgctccaggacaatgatgaaaacagggaattgctt
ggggagctggatggaatcgatgtgcttcttcagcagttatccgtgtttaaaagacacaat
cccagcacggctgaggagcaggagatgatggagaatctgtttgattccctctgctcctgt
ctaatgcttagttccaatcgtgagcgcttcctgaagggcgagggtcttcagctgatgaat
ctcatgctcagggaaaagaagatctcccggagcagtgccctgaaagtgctggaccatgcc
atgattggccccgaaggcacagacaactgccataagtttgttgacattcttggcttacga
accatctttcccctctttatgaaatctcccaggaagatcaagaaagtgggaaccactgag
aaggaacatgaagagcatgtctgttcgatcctggcttccctcctgcggaacctgagaggg
cagcagcggacccggcttctgaataaattcactgaaaatgacagtgagaaggttgacaga
ctaatggagttgcattttaaatatctgggtgcaatgcaggtggcggacaagaagattgaa
ggggaaaaacacgacatggtccggcgaggagagatcatcgacaatgacaccgaggaggag
ttctacctccggcgcctggatgcggggctctttgttctccagcacatctgctacatcatg
gccgagatctgcaatgccaatgtcccccagattcgccagagggttcaccagatcctaaac
atgcgaggaagctccatcaaaattgtcaggcatatcatcaaggagtatgcagagaacatc
ggggacggccggagcccggagttccgggagaacgagcaaaagcgcatcctgggcttgctg
gagaacttctag

DBGET integrated database retrieval system