KEGG   Homo sapiens (human): 5819
Entry
5819              CDS       T01001                                 
Symbol
NECTIN2, CD112, HVEB, PRR2, PVRL2, PVRR2
Name
(RefSeq) nectin cell adhesion molecule 2
  KO
K06531  poliovirus receptor-related protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03266  Virion - Herpesvirus
hsa04514  Cell adhesion molecules
hsa04520  Adherens junction
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03266 Virion - Herpesvirus
    5819 (NECTIN2)
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    5819 (NECTIN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    5819 (NECTIN2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    5819 (NECTIN2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    5819 (NECTIN2)
   04090 CD molecules [BR:hsa04090]
    5819 (NECTIN2)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  Nectin family
   5819 (NECTIN2)
CD molecules [BR:hsa04090]
 Proteins
  5819 (NECTIN2)
SSDB
Motif
Pfam: C2-set_2 ig Ig_3 V-set I-set Ig_2 Bactofilin TonB_C C1-set Izumo-Ig
Other DBs
NCBI-GeneID: 5819
NCBI-ProteinID: NP_001036189
OMIM: 600798
HGNC: 9707
Ensembl: ENSG00000130202
Pharos: Q92692(Tbio)
UniProt: Q92692
Structure
LinkDB
Position
19:44846297..44889223
AA seq 538 aa
MARAAALLPSRSPPTPLLWPLLLLLLLETGAQDVRVQVLPEVRGQLGGTVELPCHLLPPV
PGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAEL
QDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTV
ALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKV
EHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTS
GTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGG
IIGGIIAAIIATAVAATGILICRQQRKEQTLQGAEEDEDLEGPPSYKPPTPKAKLEAQEM
PSQLFTLGASEHSPLKTPYFDAGASCTEQEMPRYHELPTLEERSGPLHPGATSLGSPIPV
PPGPPAVEDVSLDLEDEEGEEEEEYLDKINPIYDALSYSSPSDSYQGKGFVMSRAMYV
NT seq 1617 nt   +upstreamnt  +downstreamnt
atggcccgggccgctgccctcctgccgtcgagatcgccgccgacgccgctgctgtggccg
ctgctgctgctgctgctcctggaaaccggagcccaggatgtgcgagttcaagtgctaccc
gaggtgcgaggccagctcgggggcaccgtggagctgccgtgccacctgctgccacctgtt
cctggactgtacatctccctggtgacctggcagcgcccagatgcacctgcgaaccaccag
aatgtggccgccttccaccctaagatgggtcccagcttccccagcccgaagcctggcagc
gagcggctgtccttcgtctctgccaagcagagcactgggcaagacacagaggcagagctc
caggacgccacgctggccctccacgggctcacggtggaggacgagggcaactacacttgc
gagtttgccaccttccccaaggggtccgtccgagggatgacctggctcagagtcatagcc
aagcccaagaaccaagctgaggcccagaaggtcacgttcagccaggaccctacgacagtg
gccctctgcatctccaaagagggccgcccacctgcccggatctcctggctctcatccctg
gactgggaagccaaagagactcaggtgtcagggaccctggccggaactgtcactgtcacc
agccgcttcaccttggtgccctcgggccgagcagatggtgtcacggtcacctgcaaagtg
gagcatgagagcttcgaggaaccagccctgatacctgtgaccctctctgtacgctaccct
cctgaagtgtccatctccggctatgatgacaactggtacctcggccgtactgatgccacc
ctgagctgtgacgtccgcagcaacccagagcccacgggctatgactggagcacgacctca
ggcaccttcccgacctccgcagtggcccagggctcccagctggtcatccacgcagtggac
agtctgttcaataccaccttcgtctgcacagtcaccaatgccgtgggcatgggccgcgct
gagcaggtcatctttgtccgagagacccccaacacagcaggcgcaggggccacaggcggc
atcatcgggggcatcatcgccgccatcattgctactgctgtggctgccacgggcatcctt
atctgccggcagcagcggaaggagcagacgctgcagggggcagaggaggacgaagacctg
gagggacctccctcctacaagccaccgaccccaaaagcgaagctggaggcacaggagatg
ccctcccagctcttcactctgggggcctcggagcacagcccactcaagaccccctacttt
gatgctggcgcctcatgcactgagcaggaaatgcctcgataccatgagctgcccaccttg
gaagaacggtcaggacccttgcaccctggagccacaagcctggggtcccccatcccggtg
cctccagggccacctgctgtggaagacgtttccctggatctagaggatgaggagggggag
gaggaggaagagtatctggacaagatcaaccccatctatgatgctctgtcctatagcagc
ccctctgattcctaccagggcaaaggctttgtcatgtcccgggccatgtatgtgtga

DBGET integrated database retrieval system