KEGG   Homo sapiens (human): 58477
Entry
58477             CDS       T01001                                 

Gene name
SRPRB, APMCF1, SR-beta
Definition
(RefSeq) SRP receptor subunit beta
  KO
K12272  signal recognition particle receptor subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa03060  Protein export
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    58477 (SRPRB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:hsa02044]
    58477 (SRPRB)
   04031 GTP-binding proteins [BR:hsa04031]
    58477 (SRPRB)
Secretion system [BR:hsa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   58477 (SRPRB)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Unclassified
   58477 (SRPRB)
SSDB
Motif
Pfam: SRPRB Arf MMR_HSR1 GTP_EFTU FeoB_N Roc G-alpha TIP49 Gtr1_RagA Dynamin_N MHYT
Other DBs
NCBI-GeneID: 58477
NCBI-ProteinID: NP_067026
OMIM: 616883
HGNC: 24085
Ensembl: ENSG00000144867
Vega: OTTHUMG00000159753
Pharos: Q9Y5M8(Tdark)
UniProt: Q9Y5M8 Q549N5
LinkDB
Position
3q22.1
AA seq 271 aa
MASADSRRVADGGGAGGTFQPYLDTLRQELQQTDPTLLSVVVAVLAVLLTLVFWKLIRSR
RSSQRAVLLVGLCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPG
HESLRLQFLERFKSSARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACN
KQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLK
VEFLECSAKGGRGDVGSADIQDLEKWLAKIA
NT seq 816 nt   +upstreamnt  +downstreamnt
atggcttccgcggactcgcgccgggtggcagatggcggcggtgccgggggcaccttccag
ccctacctagacaccttgcggcaggagctgcagcagacggacccaacgctgttgtcagta
gtggtggcggttcttgcggtgctgctgacgctagtcttctggaagttaatccggagcaga
aggagcagtcagagagctgttcttcttgttggcctttgtgattccgggaaaacgttgctc
tttgtcaggttgttaacaggcctttatagagacactcagacgtccattactgacagctgt
gctgtatacagagtcaacaataacaggggcaatagtctgaccttgattgaccttcccggc
catgagagtttgaggcttcagttcttagagcggtttaagtcttcagccagggctattgtg
tttgttgtggatagtgcagcattccagcgagaggtgaaagatgtggctgagtttctgtat
caagtcctcattgacagtatgggtctgaagaatacaccatcattcttaatagcctgcaat
aagcaagatattgcaatggcaaaatcagcaaagttaattcaacagcagctggagaaagaa
ctcaacaccttacgagttacccgttctgctgcccccagcacactggacagttccagcact
gcccctgctcagctggggaagaaaggcaaagagtttgaattctcacagttgcccctcaaa
gtggagttcctggagtgcagtgccaagggtggaagaggggacgtgggctctgctgacatc
caggacttggagaaatggctggctaaaattgcctga

DBGET integrated database retrieval system