KEGG   Homo sapiens (human): 5892
Entry
5892              CDS       T01001                                 
Symbol
RAD51D, BROVCA4, R51H3, RAD51L3, TRAD
Name
(RefSeq) RAD51 paralog D
  KO
K10871  RAD51-like protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03440  Homologous recombination
Disease
H02531  Familial breast-ovarian cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    5892 (RAD51D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    5892 (RAD51D)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecA family proteins
     5892 (RAD51D)
SSDB
Motif
Pfam: Rad51 AAA_25 ATPase DnaB_C RecA AAA_24 HHH_5 AAA_19 AAA_22 AAA_5 CobU CbiA ABC_tran CbiG_N AAA_18 DUF2075 AAA PAXNEB
Other DBs
NCBI-GeneID: 5892
NCBI-ProteinID: NP_002869
OMIM: 602954
HGNC: 9823
Ensembl: ENSG00000185379
Pharos: O75771(Tbio)
UniProt: O75771
Structure
LinkDB
Position
17:complement(35092221..35119860)
AA seq 328 aa
MGVLRVGLCPGLTEEMIQLLRSHRIKTVVDLVSADLEEVAQKCGLSYKALVALRRVLLAQ
FSAFPVNGADLYEELKTSTAILSTGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCM
AANVAHGLQQNVLYVDSNGGLTASRLLQLLQAKTQDEEEQAEALRRIQVVHAFDIFQMLD
VLQELRGTVAQQVTGSSGTVKVVVVDSVTAVVSPLLGGQQREGLALMMQLARELKTLARD
LGMAVVVTNHITRDRDSGRLKPALGRSWSFVPSTRILLDTIEGAGASGGRRMACLAKSSR
QPTGFQEMVDIGTWGTSEQSATLQGDQT
NT seq 987 nt   +upstreamnt  +downstreamnt
atgggcgtgctcagggtcggactgtgccctggccttaccgaggagatgatccagcttctc
aggagccacaggatcaagacagtggtggacctggtttctgcagacctggaagaggtagct
cagaaatgtggcttgtcttacaaggccctggttgccctgaggcgggtgctgctggctcag
ttctcggctttccccgtgaatggcgctgatctctacgaggaactgaagacctccactgcc
atcctgtccactggcattggcagtcttgataaactgcttgatgctggtctctatactgga
gaagtgactgaaattgtaggaggcccaggtagcggcaaaactcaggtatgtctctgtatg
gcagcaaatgtggcccatggcctgcagcaaaacgtcctatatgtagattccaatggaggg
ctgacagcttcccgcctcctccagctgcttcaggctaaaacccaggatgaggaggaacag
gcagaagctctccggaggatccaggtggtgcatgcatttgacatcttccagatgctggat
gtgctgcaggagctccgaggcactgtggcccagcaggtgactggttcttcaggaactgtg
aaggtggtggttgtggactcggtcactgcggtggtttccccacttctgggaggtcagcag
agggaaggcttggccttgatgatgcagctggcccgagagctgaagaccctggcccgggac
cttggcatggcagtggtggtgaccaaccacataactcgagacagggacagcgggaggctc
aaacctgccctcggacgctcctggagctttgtgcccagcactcggattctcctggacacc
atcgagggagcaggagcatcaggcggccggcgcatggcgtgtctggccaaatcttcccga
cagccaacaggtttccaggagatggtagacattgggacctgggggacctcagagcagagt
gccacattacagggtgatcagacatga

DBGET integrated database retrieval system