KEGG   Homo sapiens (human): 59272
Entry
59272             CDS       T01001                                 

Gene name
ACE2, ACEH
Definition
(RefSeq) angiotensin converting enzyme 2
  KO
K09708  angiotensin-converting enzyme 2 [EC:3.4.17.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04614  Renin-angiotensin system
hsa04974  Protein digestion and absorption
hsa05171  Coronavirus disease - COVID-19
Network
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01307  SARS-CoV-2 S to AngII-AT1R-NOX2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    59272 (ACE2)
  09154 Digestive system
   04974 Protein digestion and absorption
    59272 (ACE2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    59272 (ACE2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    59272 (ACE2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    59272 (ACE2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.23  angiotensin-converting enzyme 2
     59272 (ACE2)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M2
   59272 (ACE2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   59272 (ACE2)
SSDB
Motif
Pfam: Peptidase_M2 Collectrin
Other DBs
NCBI-GeneID: 59272
NCBI-ProteinID: NP_068576
OMIM: 300335
HGNC: 13557
Ensembl: ENSG00000130234
Vega: OTTHUMG00000021177
Pharos: Q9BYF1(Tchem)
UniProt: Q9BYF1
LinkDB
Structure
PDB: 

Position
Xp22.2
AA seq 805 aa
MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQ
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTIL
NTMSTIYSTGKVCNPDNPQECLLLEPGLNEIMANSLDYNERLWAWESWRSEVGKQLRPLY
EEYVVLKNEMARANHYEDYGDYWRGDYEVNGVDGYDYSRGQLIEDVEHTFEEIKPLYEHL
HAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQ
AWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKAVCHPTAWDLGKGDFRILM
CTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEIMSLSAATPKHLKS
IGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQWMKKWWEM
KREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEGPLH
KCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNK
NSFVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKN
QMILFGEEDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDN
SLEFLGIQPTLGPPNQPPVSIWLIVFGVVMGVIVVGIVILIFTGIRDRKKKNKARSGENP
YASIDISKGENNPGFQNTDDVQTSF
NT seq 2418 nt   +upstreamnt  +downstreamnt
atgtcaagctcttcctggctccttctcagccttgttgctgtaactgctgctcagtccacc
attgaggaacaggccaagacatttttggacaagtttaaccacgaagccgaagacctgttc
tatcaaagttcacttgcttcttggaattataacaccaatattactgaagagaatgtccaa
aacatgaataatgctggggacaaatggtctgcctttttaaaggaacagtccacacttgcc
caaatgtatccactacaagaaattcagaatctcacagtcaagcttcagctgcaggctctt
cagcaaaatgggtcttcagtgctctcagaagacaagagcaaacggttgaacacaattcta
aatacaatgagcaccatctacagtactggaaaagtttgtaacccagataatccacaagaa
tgcttattacttgaaccaggtttgaatgaaataatggcaaacagtttagactacaatgag
aggctctgggcttgggaaagctggagatctgaggtcggcaagcagctgaggccattatat
gaagagtatgtggtcttgaaaaatgagatggcaagagcaaatcattatgaggactatggg
gattattggagaggagactatgaagtaaatggggtagatggctatgactacagccgcggc
cagttgattgaagatgtggaacatacctttgaagagattaaaccattatatgaacatctt
catgcctatgtgagggcaaagttgatgaatgcctatccttcctatatcagtccaattgga
tgcctccctgctcatttgcttggtgatatgtggggtagattttggacaaatctgtactct
ttgacagttccctttggacagaaaccaaacatagatgttactgatgcaatggtggaccag
gcctgggatgcacagagaatattcaaggaggccgagaagttctttgtatctgttggtctt
cctaatatgactcaaggattctgggaaaattccatgctaacggacccaggaaatgttcag
aaagcagtctgccatcccacagcttgggacctggggaagggcgacttcaggatccttatg
tgcacaaaggtgacaatggacgacttcctgacagctcatcatgagatggggcatatccag
tatgatatggcatatgctgcacaaccttttctgctaagaaatggagctaatgaaggattc
catgaagctgttggggaaatcatgtcactttctgcagccacacctaagcatttaaaatcc
attggtcttctgtcacccgattttcaagaagacaatgaaacagaaataaacttcctgctc
aaacaagcactcacgattgttgggactctgccatttacttacatgttagagaagtggagg
tggatggtctttaaaggggaaattcccaaagaccagtggatgaaaaagtggtgggagatg
aagcgagagatagttggggtggtggaacctgtgccccatgatgaaacatactgtgacccc
gcatctctgttccatgtttctaatgattactcattcattcgatattacacaaggaccctt
taccaattccagtttcaagaagcactttgtcaagcagctaaacatgaaggccctctgcac
aaatgtgacatctcaaactctacagaagctggacagaaactgttcaatatgctgaggctt
ggaaaatcagaaccctggaccctagcattggaaaatgttgtaggagcaaagaacatgaat
gtaaggccactgctcaactactttgagcccttatttacctggctgaaagaccagaacaag
aattcttttgtgggatggagtaccgactggagtccatatgcagaccaaagcatcaaagtg
aggataagcctaaaatcagctcttggagataaagcatatgaatggaacgacaatgaaatg
tacctgttccgatcatctgttgcatatgctatgaggcagtactttttaaaagtaaaaaat
cagatgattctttttggggaggaggatgtgcgagtggctaatttgaaaccaagaatctcc
tttaatttctttgtcactgcacctaaaaatgtgtctgatatcattcctagaactgaagtt
gaaaaggccatcaggatgtcccggagccgtatcaatgatgctttccgtctgaatgacaac
agcctagagtttctggggatacagccaacacttggacctcctaaccagccccctgtttcc
atatggctgattgtttttggagttgtgatgggagtgatagtggttggcattgtcatcctg
atcttcactgggatcagagatcggaagaagaaaaataaagcaagaagtggagaaaatcct
tatgcctccatcgatattagcaaaggagaaaataatccaggattccaaaacactgatgat
gttcagacctccttttag

DBGET integrated database retrieval system