KEGG   Homo sapiens (human): 6095
Entry
6095              CDS       T01001                                 
Symbol
RORA, IDDECA, NR1F1, ROR1, ROR2, ROR3, RZR-ALPHA, RZRA
Name
(RefSeq) RAR related orphan receptor A
  KO
K08532  RAR-related orphan receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04659  Th17 cell differentiation
hsa04710  Circadian rhythm
hsa05017  Spinocerebellar ataxia
hsa05321  Inflammatory bowel disease
Network
nt06440  Transcription
nt06462  Spinocerebellar ataxia
  Element
N00965  RORA-mediated transcription
N00966  Mutation-caused aberrant ATXN1 to RORA-mediated transcription
Disease
H02463  Syndromic intellectual developmental disorder
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    6095 (RORA)
  09159 Environmental adaptation
   04710 Circadian rhythm
    6095 (RORA)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    6095 (RORA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    6095 (RORA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6095 (RORA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    6095 (RORA)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    6095 (RORA)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1F. RAR-related orphan receptor
   6095 (RORA)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 6095
NCBI-ProteinID: NP_599023
OMIM: 600825
HGNC: 10258
Ensembl: ENSG00000069667
Pharos: P35398(Tchem)
UniProt: P35398
Structure
LinkDB
Position
15:complement(60488284..61229302)
AA seq 523 aa
MESAPAAPDPAASEPGSSGADAAAGSRETPLNQESARKSEPPAPVRRQSYSSTSRGISVT
KKTHTSQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRT
SRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAE
PLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIK
PEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNISKSHLETCQYLREELQQITW
QTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGS
LEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEI
ALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRAL
CGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggagtcagctccggcagcccccgaccccgccgccagcgagccaggcagcagcggcgcg
gacgcggccgccggctccagggagaccccgctgaaccaggaatccgcccgcaagagcgag
ccgcctgccccggtgcgcagacagagctattccagcaccagcagaggtatctcagtaacg
aagaagacacatacatctcaaattgaaattattccatgcaagatctgtggagacaaatca
tcaggaatccattatggtgtcattacatgtgaaggctgcaagggctttttcaggagaagt
cagcaaagcaatgccacctactcctgtcctcgtcagaagaactgtttgattgatcgaacc
agtagaaaccgctgccaacactgtcgattacagaaatgccttgccgtagggatgtctcga
gatgctgtaaaatttggccgaatgtcaaaaaagcagagagacagcttgtatgcagaagta
cagaaacaccggatgcagcagcagcagcgcgaccaccagcagcagcctggagaggctgag
ccgctgacgcccacctacaacatctcggccaacgggctgacggaacttcacgacgacctc
agtaactacattgacgggcacacccctgaggggagtaaggcagactccgccgtcagcagc
ttctacctggacatacagccttccccagaccagtcaggtcttgatatcaatggaatcaaa
ccagaaccaatatgtgactacacaccagcatcaggcttctttccctactgttcgttcacc
aacggcgagacttccccaactgtgtccatggcagaattagaacaccttgcacagaatata
tctaaatcgcatctggaaacctgccaatacttgagagaagagctccagcagataacgtgg
cagacctttttacaggaagaaattgagaactatcaaaacaagcagcgggaggtgatgtgg
caattgtgtgccatcaaaattacagaagctatacagtatgtggtggagtttgccaaacgc
attgatggatttatggaactgtgtcaaaatgatcaaattgtgcttctaaaagcaggttct
ctagaggtggtgtttatcagaatgtgccgtgcctttgactctcagaacaacaccgtgtac
tttgatgggaagtatgccagccccgacgtcttcaaatccttaggttgtgaagactttatt
agctttgtgtttgaatttggaaagagtttatgttctatgcacctgactgaagatgaaatt
gcattattttctgcatttgtactgatgtcagcagatcgctcatggctgcaagaaaaggta
aaaattgaaaaactgcaacagaaaattcagctagctcttcaacacgtcctacagaagaat
caccgagaagatggaatactaacaaagttaatatgcaaggtgtctaccttaagagcctta
tgtggacgacatacagaaaagctaatggcatttaaagcaatatacccagacattgtgcga
cttcattttcctccattatacaaggagttgttcacttcagaatttgagccagcaatgcaa
attgatgggtaa

KEGG   Homo sapiens (human): 6096
Entry
6096              CDS       T01001                                 
Symbol
RORB, EIG15, NR1F2, ROR-BETA, RZR-BETA, RZRB, bA133M9.1
Name
(RefSeq) RAR related orphan receptor B
  KO
K08533  RAR-related orphan receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04710  Circadian rhythm
Disease
H00808  Idiopathic generalized epilepsies
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    6096 (RORB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6096 (RORB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    6096 (RORB)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    6096 (RORB)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1F. RAR-related orphan receptor
   6096 (RORB)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 6096
NCBI-ProteinID: NP_001351952
OMIM: 601972
HGNC: 10259
Ensembl: ENSG00000198963
LinkDB
Position
9:74497335..74693177
AA seq 470 aa
MCENQLKTKADATAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQ
RNCLIDRTNRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQRLQEQRQ
QQSGEAEALARVYSSSISNGLSNLNNETSGTYANGHVIDLPKSEGYYNVDSGQPSPDQSG
LDMTGIKQIKQEPIYDLTSVPNLFTYSSFNNGQLAPGITMTEIDRIAQNIIKSHLETCQY
TMEELHQLAWQTHTYEEIKAYQSKSREALWQQCAIQITHAIQYVVEFAKRITGFMELCQN
DQILLLKSGCLEVVLVRMCRAFNPLNNTVLFEGKYGGMQMFKALGSDDLVNEAFDFAKNL
CSLQLTEEEIALFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKL
IAKIPTITAVCNLHGEKLQVFKQSHPEIVNTLFPPLYKELFNPDCATGCK
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgtgtgagaaccagctcaaaactaaagctgacgccactgcacaaattgaagtgatacca
tgcaaaatttgtggcgataagtcctctgggatccactacggagtcatcacatgtgaaggc
tgcaagggattctttaggaggagccagcagaacaatgcttcttattcctgcccaaggcag
agaaactgtttaattgacagaacgaacagaaaccgttgccaacactgccgactgcagaag
tgtcttgccctaggaatgtcaagagatgctgtgaagtttgggaggatgtccaagaagcaa
agggacagcctgtatgctgaggtgcagaagcaccagcagcggctgcaggaacagcggcag
cagcagagtggggaggcagaagcccttgccagggtgtacagcagcagcattagcaacggc
ctgagcaacctgaacaacgagaccagcggcacttatgccaacgggcacgtcattgacctg
cccaagtctgagggttattacaacgtcgattccggtcagccgtcccctgatcagtcagga
cttgacatgactggaatcaaacagataaagcaagaacctatctatgacctcacatccgta
cccaacttgtttacctatagctctttcaacaatgggcagttagcaccagggataaccatg
actgaaatcgaccgaattgcacagaacatcattaagtcccatttggagacatgtcaatac
accatggaagagctgcaccagctggcgtggcagacccacacctatgaagaaattaaagca
tatcaaagcaagtccagggaagcactgtggcaacaatgtgccatccagatcactcacgcc
atccaatacgtggtggagtttgcaaagcggataacaggcttcatggagctctgtcaaaat
gatcaaattctacttctgaagtcaggttgcttggaagtggttttagtgagaatgtgccgt
gccttcaacccattaaacaacactgttctgtttgaaggaaaatatggaggaatgcaaatg
ttcaaagccttaggttctgatgacctagtgaatgaagcatttgactttgcaaagaatttg
tgttccttgcagctgaccgaggaggagatcgctttgttctcatctgctgttctgatatct
ccagaccgagcctggcttatagaaccaaggaaagtccagaagcttcaggaaaaaatttat
tttgcacttcaacatgtgattcagaagaatcacctggatgatgagaccttggcaaagtta
atagccaagataccaaccatcacggcagtttgcaacttgcacggggagaagctgcaggta
tttaagcaatctcatccagagatagtgaatacactgtttcctccgttatacaaggagctc
tttaatcctgactgtgccaccggctgcaaatga

KEGG   Homo sapiens (human): 6097
Entry
6097              CDS       T01001                                 
Symbol
RORC, IMD42, NR1F3, RORG, RZR-GAMMA, RZRG, TOR
Name
(RefSeq) RAR related orphan receptor C
  KO
K08534  RAR-related orphan receptor gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04659  Th17 cell differentiation
hsa04710  Circadian rhythm
hsa05321  Inflammatory bowel disease
Disease
H00089  IFN-gamma/IL-12 axis
Drug target
Cedirogant: D12274
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    6097 (RORC)
  09159 Environmental adaptation
   04710 Circadian rhythm
    6097 (RORC)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    6097 (RORC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6097 (RORC)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    6097 (RORC)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    6097 (RORC)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1F. RAR-related orphan receptor
   6097 (RORC)
SSDB
Motif
Pfam: zf-C4 Hormone_recep DUF4647 PX
Other DBs
NCBI-GeneID: 6097
NCBI-ProteinID: NP_005051
OMIM: 602943
HGNC: 10260
Ensembl: ENSG00000143365
Pharos: P51449(Tchem)
UniProt: P51449 Q6I9R9
Structure
LinkDB
Position
1:complement(151806071..151831802)
AA seq 518 aa
MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQR
CNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQK
QLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS
GSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPG
LGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIF
SREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEV
VLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALY
TALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHV
ERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK
NT seq 1557 nt   +upstreamnt  +downstreamnt
atggacagggccccacagagacagcaccgagcctcacgggagctgctggctgcaaagaag
acccacacctcacaaattgaagtgatcccttgcaaaatctgtggggacaagtcgtctggg
atccactacggggttatcacctgtgaggggtgcaagggcttcttccgccggagccagcgc
tgtaacgcggcctactcctgcacccgtcagcagaactgccccatcgaccgcaccagccga
aaccgatgccagcactgccgcctgcagaaatgcctggcgctgggcatgtcccgagatgct
gtcaagttcggccgcatgtccaagaagcagagggacagcctgcatgcagaagtgcagaaa
cagctgcagcagcggcaacagcagcaacaggaaccagtggtcaagacccctccagcaggg
gcccaaggagcagataccctcacctacaccttggggctcccagacgggcagctgcccctg
ggctcctcgcctgacctgcctgaggcttctgcctgtccccctggcctcctgaaagcctca
ggctctgggccctcatattccaacaacttggccaaggcagggctcaatggggcctcatgc
caccttgaatacagccctgagcggggcaaggctgagggcagagagagcttctatagcaca
ggcagccagctgacccctgaccgatgtggacttcgttttgaggaacacaggcatcctggg
cttggggaactgggacagggcccagacagctacggcagccccagtttccgcagcacaccg
gaggcaccctatgcctccctgacagagatagagcacctggtgcagagcgtctgcaagtcc
tacagggagacatgccagctgcggctggaggacctgctgcggcagcgctccaacatcttc
tcccgggaggaagtgactggctaccagaggaagtccatgtgggagatgtgggaacggtgt
gcccaccacctcaccgaggccattcagtacgtggtggagttcgccaagaggctctcaggc
tttatggagctctgccagaatgaccagattgtgcttctcaaagcaggagcaatggaagtg
gtgctggttaggatgtgccgggcctacaatgctgacaaccgcacggtcttttttgaaggc
aaatacggtggcatggagctgttccgagccttgggctgcagcgagctcatcagctccatc
tttgacttctcccactccctaagtgccttgcacttttccgaggatgagattgccctctac
acagcccttgttctcatcaatgcccatcggccagggctccaagagaaaaggaaagtagaa
cagctgcagtacaatctggagctggcctttcatcatcatctctgcaagactcatcgccaa
agcatcctggcaaagctgccacccaaggggaagcttcggagcctgtgtagccagcatgtg
gaaaggctgcagatcttccagcacctccaccccatcgtggtccaagccgctttccctcca
ctctacaaggagctcttcagcactgaaaccgagtcacctgtggggctgtccaagtga

DBGET integrated database retrieval system