KEGG   Homo sapiens (human): 6136
Entry
6136              CDS       T01001                                 
Symbol
RPL12, L12
Name
(RefSeq) ribosomal protein L12
  KO
K02870  large subunit ribosomal protein L12e
Organism
hsa  Homo sapiens (human)
Pathway
hsa03010  Ribosome
hsa05171  Coronavirus disease - COVID-19
Network
nt06141  Translation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01317  Translation initiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    6136 (RPL12)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    6136 (RPL12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:hsa03011]
    6136 (RPL12)
Ribosome [BR:hsa03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    6136 (RPL12)
SSDB
Motif
Pfam: Ribosomal_L11_N Ribosomal_L11
Other DBs
NCBI-GeneID: 6136
NCBI-ProteinID: NP_000967
OMIM: 180475
HGNC: 10302
Ensembl: ENSG00000197958
Pharos: P30050(Tbio)
UniProt: P30050
Structure
LinkDB
Position
9:complement(127447674..127451406)
AA seq 165 aa
MPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITV
KLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRS
LARELSGTIKEILGTAQSVGCNVDGRHPHDIIDDINSGAVECPAS
NT seq 498 nt   +upstreamnt  +downstreamnt
atgccgccgaagttcgaccccaacgagatcaaagtcgtatacctgaggtgcaccggaggt
gaagtcggtgccacttctgccctggcccccaagatcggccccctgggtctgtctccaaaa
aaagttggtgatgacattgccaaggcaacgggtgactggaagggcctgaggattacagtg
aaactgaccattcagaacagacaggcccagattgaggtggtgccttctgcctctgccctg
atcatcaaagccctcaaggaaccaccaagagacagaaagaaacagaaaaacattaaacac
agtgggaatatcacttttgatgagattgtcaacattgctcgacagatgcggcaccgatcc
ttagccagagaactctctggaaccattaaagagatcctggggactgcccagtcagtgggc
tgtaatgttgatggccgccatcctcatgacatcatcgatgacatcaacagtggtgctgtg
gaatgcccagccagttaa

DBGET integrated database retrieval system