KEGG   Homo sapiens (human): 6272
Entry
6272              CDS       T01001                                 
Symbol
SORT1, Gp95, LDLCQ6, NT3, NTR3
Name
(RefSeq) sortilin 1
  KO
K12388  sortilin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa04722  Neurotrophin signaling pathway
hsa04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    6272 (SORT1)
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    6272 (SORT1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    6272 (SORT1)
SSDB
Motif
Pfam: Sortilin-Vps10 Sortilin_C BNR_6 BNR
Other DBs
NCBI-GeneID: 6272
NCBI-ProteinID: NP_002950
OMIM: 602458
HGNC: 11186
Ensembl: ENSG00000134243
Pharos: Q99523(Tchem)
UniProt: Q99523
Structure
LinkDB
Position
1:complement(109309575..109397918)
AA seq 831 aa
MERPWGAADGLSRWPHGLGLLLLLQLLPPSTLSQDRLDAPPPPAAPLPRWSGPIGVSWGL
RAAAAGGAFPRGGRWRRSAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDS
TGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSG
KVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLW
VSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIG
VKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDM
VFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLS
EDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLS
EPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHS
SRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSY
TIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVT
KQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPG
DKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKK
YVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE
NT seq 2496 nt   +upstreamnt  +downstreamnt
atggagcggccctggggagctgcggacggcctctcgcgctggccccatggcctcggcctc
ctcctcctcctgcagctgctgccgccgtcgaccctcagccaggaccggctggacgcgccg
ccgccgcccgctgcgccgctgccgcgctggtctggccccatcggggtgagctgggggctg
cgggcggccgcagccgggggcgcgtttccccgcggcggccgttggcgtcgcagcgcgccg
ggcgaggacgaggagtgcggccgggtccgggacttcgtcgccaagctggccaacaacacg
caccagcatgtgtttgatgatctcagaggctcagtatccttgtcctgggttggagatagc
actggggtcattctagtcttgactaccttccatgtaccactggtaattatgacttttgga
cagtccaagctatatcgaagtgaggattatgggaagaactttaaggatattacagatctc
atcaataacacctttattcggactgaatttggcatggctattggtcctgagaactctgga
aaggtggtgttaacagcagaggtgtctggaggaagtcgtggaggaagaatctttagatca
tcagattttgcgaagaattttgtgcaaacagatctcccttttcatcctctcactcagatg
atgtatagccctcagaattctgattatcttttagctctcagcactgaaaatggcctgtgg
gtgtccaagaattttgggggaaaatgggaagaaatccacaaagcagtatgtttggccaaa
tggggatcagacaacaccatcttctttacaacctatgcaaatggctcctgcaaagctgac
cttggggctctggaattatggagaacttcagacttgggaaaaagcttcaaaactattggt
gtgaaaatctactcatttggtcttgggggacgtttcctttttgcctctgtgatggctgat
aaggatacaacaagaaggatccacgtttcaacagatcaaggggacacatggagcatggcc
cagctcccctccgtgggacaggaacagttctattctattctggcagcaaatgatgacatg
gtattcatgcatgtagatgaacctggagacactgggtttggcacaatctttacctcagat
gatcgaggcattgtctattccaagtctttggaccgacatctctacactaccacaggcgga
gagacggactttaccaacgtgacctccctccgcggcgtctacataacaagcgtgctctcc
gaagataattctatccagaccatgatcacttttgaccaaggaggaaggtggacgcacctg
aggaagcctgaaaacagtgaatgtgatgctacagcaaaaaacaagaatgagtgcagcctt
catattcatgcttcctacagcatctcccagaaactgaatgttccaatggccccactctca
gagccgaatgccgtaggcattgtcattgctcatggtagcgtgggggatgccatctcagtg
atggttccagatgtgtacatctcagatgatgggggttactcctggacaaagatgctggaa
ggaccccactattacaccatcctggattctggaggcatcattgtggccattgagcacagc
agccgtcctatcaatgtgattaagttctccacagacgaaggtcaatgctggcaaacctac
acgttcaccagggaccccatctatttcactggcctagcttcagaacctggagctaggtcc
atgaatatcagcatttggggcttcacagaatctttcctgaccagccagtgggtctcctac
accattgattttaaagatatccttgaaaggaactgtgaagagaaggactataccatatgg
ctggcacactccacagaccctgaagattatgaagatggctgcattttgggctacaaagaa
cagtttctgcggctacgcaagtcatccgtgtgtcagaatggtcgagactatgttgtgacc
aagcagccctccatctgcctctgttccctggaggactttctctgtgattttggctactac
cgtccagaaaatgactccaagtgtgtggaacagccagaactgaagggccacgacctggag
ttttgtctgtacggaagagaagaacacctaacaacaaatgggtaccggaaaattccaggg
gacaaatgccagggtggggtaaatccagttcgagaagtaaaagacttgaaaaagaaatgc
acaagcaactttttgagtccggaaaaacagaattccaagtcaaattctgttccaattatc
ctggccatcgtgggattgatgctggtcacagtcgtagcaggagtgctcattgtgaagaaa
tatgtctgtgggggaaggttcctggtgcatcgatactctgtgctgcagcagcatgcagag
gccaatggtgtggatggtgtggatgctttggacacagcctcccacactaataaaagtggt
tatcatgatgactcagatgaggacctcttggaatag

DBGET integrated database retrieval system