KEGG   Homo sapiens (human): 6352
Entry
6352              CDS       T01001                                 
Symbol
CCL5, D17S136E, RANTES, SCYA5, SIS-delta, SISd, TCP228, eoCP
Name
(RefSeq) C-C motif chemokine ligand 5
  KO
K12499  C-C motif chemokine 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04668  TNF signaling pathway
hsa05020  Prion disease
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05131  Shigellosis
hsa05142  Chagas disease
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
hsa05323  Rheumatoid arthritis
hsa05417  Lipid and atherosclerosis
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
N00428  CCR5-GNB/G-PLCB/G-PKC signaling pathway
N00429  HCMV UL22A to CCR5-GNB/G-PLCB/G-PKC signaling pathway
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
N01181  CCL5/7/11/13/15/24/26/27/28 to CCR3 signaling
N01182  VAV vCCI to CCR signaling
N01183  CCL5/11/13/26/28 to HCMV US28 signaling
N01184  CCL5 to HHV6 U12 signaling
N01185  CCL5/11 to HHV6 U51 signaling
N01190  CCL5/17/22 to CCR4 signaling
N01196  CCL3/4/5/8 to CCR5 signaling
Disease
H01358  Atopic dermatitis
H01360  Allergic rhinitis
H01563  HIV infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    6352 (CCL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6352 (CCL5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6352 (CCL5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6352 (CCL5)
   04621 NOD-like receptor signaling pathway
    6352 (CCL5)
   04623 Cytosolic DNA-sensing pathway
    6352 (CCL5)
   04062 Chemokine signaling pathway
    6352 (CCL5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    6352 (CCL5)
   05168 Herpes simplex virus 1 infection
    6352 (CCL5)
   05163 Human cytomegalovirus infection
    6352 (CCL5)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    6352 (CCL5)
   05131 Shigellosis
    6352 (CCL5)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    6352 (CCL5)
  09163 Immune disease
   05323 Rheumatoid arthritis
    6352 (CCL5)
  09164 Neurodegenerative disease
   05020 Prion disease
    6352 (CCL5)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    6352 (CCL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6352 (CCL5)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6352 (CCL5)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6352 (CCL5)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Chemokines
   6352 (CCL5)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6352
NCBI-ProteinID: NP_002976
OMIM: 187011
HGNC: 10632
Ensembl: ENSG00000271503
Pharos: P13501(Tchem)
UniProt: P13501 D0EI67
Structure
LinkDB
Position
17:complement(35871491..35880360)
AA seq 91 aa
MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNP
AVVFVTRKNRQVCANPEKKWVREYINSLEMS
NT seq 276 nt   +upstreamnt  +downstreamnt
atgaaggtctccgcggcagccctcgctgtcatcctcattgctactgccctctgcgctcct
gcatctgcctccccatattcctcggacaccacaccctgctgctttgcctacattgcccgc
ccactgccccgtgcccacatcaaggagtatttctacaccagtggcaagtgctccaaccca
gcagtcgtctttgtcacccgaaagaaccgccaagtgtgtgccaacccagagaagaaatgg
gttcgggagtacatcaactctttggagatgagctag

KEGG   Homo sapiens (human): 6361
Entry
6361              CDS       T01001                                 
Symbol
CCL17, A-152E5.3, ABCD-2, SCYA17, TARC
Name
(RefSeq) C-C motif chemokine ligand 17
  KO
K21083  C-C motif chemokine 17
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01190  CCL5/17/22 to CCR4 signaling
N01193  CCL17/22 to HHV7 U12 signaling
N01194  CCL17/22 to HHV7 U51 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6361 (CCL17)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6361 (CCL17)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    6361 (CCL17)
   04657 IL-17 signaling pathway
    6361 (CCL17)
   04062 Chemokine signaling pathway
    6361 (CCL17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6361 (CCL17)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6361 (CCL17)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6361
NCBI-ProteinID: NP_002978
OMIM: 601520
HGNC: 10615
Ensembl: ENSG00000102970
Pharos: Q92583(Tbio)
UniProt: Q92583
Structure
LinkDB
Position
16:57396093..57416063
AA seq 94 aa
MAPLKMLALVTLLLGASLQHIHAARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRD
AIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
NT seq 285 nt   +upstreamnt  +downstreamnt
atggccccactgaagatgctggccctggtcaccctcctcctgggggcttctctgcagcac
atccacgcagctcgagggaccaatgtgggccgggagtgctgcctggagtacttcaaggga
gccattccccttagaaagctgaagacgtggtaccagacatctgaggactgctccagggat
gccatcgtttttgtaactgtgcagggcagggccatctgttcggaccccaacaacaagaga
gtgaagaatgcagttaaatacctgcaaagccttgagaggtcttga

KEGG   Homo sapiens (human): 6367
Entry
6367              CDS       T01001                                 
Symbol
CCL22, A-152E5.1, ABCD-1, DC/B-CK, MDC, SCYA22, STCP-1
Name
(RefSeq) C-C motif chemokine ligand 22
  KO
K21095  C-C motif chemokine 22
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04625  C-type lectin receptor signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01190  CCL5/17/22 to CCR4 signaling
N01192  HSV2 SgG2 to CCR signaling
N01193  CCL17/22 to HHV7 U12 signaling
N01194  CCL17/22 to HHV7 U51 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6367 (CCL22)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6367 (CCL22)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    6367 (CCL22)
   04062 Chemokine signaling pathway
    6367 (CCL22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6367 (CCL22)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6367 (CCL22)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6367
NCBI-ProteinID: NP_002981
OMIM: 602957
HGNC: 10621
Ensembl: ENSG00000102962
Pharos: O00626(Tbio)
UniProt: O00626
LinkDB
Position
16:57357909..57366189
AA seq 93 aa
MDRLQTALLVVLVLLAVALQATEAGPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSC
PRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ
NT seq 282 nt   +upstreamnt  +downstreamnt
atggatcgcctacagactgcactcctggttgtcctcgtcctccttgctgtggcgcttcaa
gcaactgaggcaggcccctacggcgccaacatggaagacagcgtctgctgccgtgattac
gtccgttaccgtctgcccctgcgcgtggtgaaacacttctactggacctcagactcctgc
ccgaggcctggcgtggtgttgctaaccttcagggataaggagatctgtgccgatcccaga
gtgccctgggtgaagatgattctcaataagctgagccaatga

DBGET integrated database retrieval system