KEGG   Homo sapiens (human): 6363
Entry
6363              CDS       T01001                                 
Symbol
CCL19, CKb11, ELC, MIP-3b, MIP3B, SCYA19
Name
(RefSeq) C-C motif chemokine ligand 19
  KO
K05512  C-C motif chemokine 19
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01229  CCL19/21 to CCR7/11 signaling
N01230  CCL19 to HHV6 U51 signaling
N01231  CCL19/21 to HHV7 U12 signaling
N01232  CCL19/21 to HHV7 U51 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    6363 (CCL19)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6363 (CCL19)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6363 (CCL19)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6363 (CCL19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6363 (CCL19)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6363 (CCL19)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6363
NCBI-ProteinID: NP_006265
OMIM: 602227
HGNC: 10617
Ensembl: ENSG00000172724
Pharos: Q99731(Tbio)
UniProt: Q99731 Q6IBD6
Structure
LinkDB
Position
9:complement(34689570..34691276)
AA seq 98 aa
MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAV
VFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS
NT seq 297 nt   +upstreamnt  +downstreamnt
atggccctgctactggccctcagcctgctggttctctggacttccccagccccaactctg
agtggcaccaatgatgctgaagactgctgcctgtctgtgacccagaaacccatccctggg
tacatcgtgaggaacttccactaccttctcatcaaggatggctgcagggtgcctgctgta
gtgttcaccacactgaggggccgccagctctgtgcacccccagaccagccctgggtagaa
cgcatcatccagagactgcagaggacctcagccaagatgaagcgccgcagcagttaa

KEGG   Homo sapiens (human): 6366
Entry
6366              CDS       T01001                                 
Symbol
CCL21, 6Ckine, CKb9, ECL, SCYA21, SLC, TCA4
Name
(RefSeq) C-C motif chemokine ligand 21
  KO
K16062  C-C motif chemokine 21
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01229  CCL19/21 to CCR7/11 signaling
N01231  CCL19/21 to HHV7 U12 signaling
N01232  CCL19/21 to HHV7 U51 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    6366 (CCL21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6366 (CCL21)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6366 (CCL21)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6366 (CCL21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6366 (CCL21)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6366 (CCL21)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6366
NCBI-ProteinID: NP_002980
OMIM: 602737
HGNC: 10620
Ensembl: ENSG00000137077
Pharos: O00585(Tbio)
UniProt: O00585
Structure
LinkDB
Position
9:complement(34709005..34710136)
AA seq 134 aa
MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIP
AILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSK
GCKRTERSQTPKGP
NT seq 405 nt   +upstreamnt  +downstreamnt
atggctcagtcactggctctgagcctccttatcctggttctggcctttggcatccccagg
acccaaggcagtgatggaggggctcaggactgttgcctcaagtacagccaaaggaagatt
cccgccaaggttgtccgcagctaccggaagcaggaaccaagcttaggctgctccatccca
gctatcctgttcttgccccgcaagcgctctcaggcagagctatgtgcagacccaaaggag
ctctgggtgcagcagctgatgcagcatctggacaagacaccatccccacagaaaccagcc
cagggctgcaggaaggacaggggggcctccaagactggcaagaaaggaaagggctccaaa
ggctgcaagaggactgagcggtcacagacccctaaagggccatag

DBGET integrated database retrieval system