Homo sapiens (human): 6372 Help Entry 6372              CDS       T01001                                  Symbol CXCL6, CKA-3, GCP-2, GCP2, SCYB6 Name (RefSeq) C-X-C motif chemokine ligand 6   KO K05506   C-X-C motif chemokine 5/6 Organism hsa  Homo sapiens (human) Pathway hsa04060   Cytokine-cytokine receptor interaction hsa04061   Viral protein interaction with cytokine and cytokine receptor hsa04062   Chemokine signaling pathway hsa04657   IL-17 signaling pathway hsa04668   TNF signaling pathway hsa05133   Pertussis hsa05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     6372 (CXCL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     6372 (CXCL6)    04061 Viral protein interaction with cytokine and cytokine receptor     6372 (CXCL6)  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     6372 (CXCL6)    04062 Chemokine signaling pathway     6372 (CXCL6)  09160 Human Diseases   09171 Infectious disease: bacterial    05133 Pertussis     6372 (CXCL6)   09163 Immune disease    05323 Rheumatoid arthritis     6372 (CXCL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hsa04052]     6372 (CXCL6) Cytokines and neuropeptides [BR:hsa04052]  Cytokines   Chemokines    6372 (CXCL6) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CBM13-like Motif Other DBs NCBI-GeneID:  6372 NCBI-ProteinID:  NP_002984 OMIM:  138965 HGNC:  10643 Ensembl:  ENSG00000124875 Pharos:  P80162(Tbio) UniProt:  P80162 LinkDB All DBs Position 4:73836678..73838760 Genome browser AA seq 114 aa AA seqDB search MSLPSSRAARVPGPSGSLCALLALLLLLTPPGPLASAGPVSAVLTELRCTCLRVTLRVNP KTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLDPEAPFLKKVIQKILDSGNKKN NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgagcctcccgtccagccgcgcggcccgtgtcccgggtccttcgggctccttgtgcgcg ctgctcgcgctgctgctcctgctgacgccgccggggcccctcgccagcgctggtcctgtc tctgctgtgctgacagagctgcgttgcacttgtttacgcgttacgctgagagtaaacccc aaaacgattggtaaactgcaggtgttccccgcaggcccgcagtgctccaaggtggaagtg gtagcctccctgaagaacgggaagcaagtttgtctggacccggaagccccttttctaaag aaagtcatccagaaaattttggacagtggaaacaagaaaaactga

Homo sapiens (human): 6374 Help Entry 6374              CDS       T01001                                  Symbol CXCL5, ENA-78, SCYB5 Name (RefSeq) C-X-C motif chemokine ligand 5   KO K05506   C-X-C motif chemokine 5/6 Organism hsa  Homo sapiens (human) Pathway hsa04060   Cytokine-cytokine receptor interaction hsa04061   Viral protein interaction with cytokine and cytokine receptor hsa04062   Chemokine signaling pathway hsa04657   IL-17 signaling pathway hsa04668   TNF signaling pathway hsa05133   Pertussis hsa05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:hsa00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     6374 (CXCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     6374 (CXCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     6374 (CXCL5)  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     6374 (CXCL5)    04062 Chemokine signaling pathway     6374 (CXCL5)  09160 Human Diseases   09171 Infectious disease: bacterial    05133 Pertussis     6374 (CXCL5)   09163 Immune disease    05323 Rheumatoid arthritis     6374 (CXCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hsa04052]     6374 (CXCL5) Cytokines and neuropeptides [BR:hsa04052]  Cytokines   Chemokines    6374 (CXCL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  6374 NCBI-ProteinID:  NP_002985 OMIM:  600324 HGNC:  10642 Ensembl:  ENSG00000163735 Pharos:  P42830(Tbio) UniProt:  P42830 Q6I9S7 Structure PDB LinkDB All DBs Position 4:complement(73995642..73998677) Genome browser AA seq 114 aa AA seqDB search MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHP KMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atgagcctcctgtccagccgcgcggcccgtgtccccggtccttcgagctccttgtgcgcg ctgttggtgctgctgctgctgctgacgcagccagggcccatcgccagcgctggtcctgcc gctgctgtgttgagagagctgcgttgcgtttgtttacagaccacgcaaggagttcatccc aaaatgatcagtaatctgcaagtgttcgccataggcccacagtgctccaaggtggaagtg gtagcctccctgaagaacgggaaggaaatttgtcttgatccagaagccccttttctaaag aaagtcatccagaaaattttggacggtggaaacaaggaaaactga

DBGET integrated database retrieval system