KEGG   Homo sapiens (human): 64111
Entry
64111             CDS       T01001                                 
Symbol
NPVF, C7orf9, RFRP
Name
(RefSeq) neuropeptide VF precursor
  KO
K25692  pro-FMRFamide-related neuropeptide VF
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    64111 (NPVF)
SSDB
Other DBs
NCBI-GeneID: 64111
NCBI-ProteinID: NP_071433
OMIM: 616984
HGNC: 13782
Ensembl: ENSG00000105954
Pharos: Q9HCQ7(Tdark)
CPD: C16045 C16109 C16110
UniProt: Q9HCQ7
LinkDB
Position
7:complement(25224570..25228486)
AA seq 196 aa
MEIISSKLFILLTLATSSLLTSNIFCADELVMSNLHSKENYDKYSEPRGYPKGERSLNFE
ELKDWGPKNVIKMSTPAVNKMPHSFANLPLRFGRNVQEERSAGATANLPLRSGRNMEVSL
VRRVPNLPQRFGRTTTAKSVCRMLSDLCQGSMHSPCANDLFYSMTCQHQEIQNPDQKQSR
RLLFKKIDDAELKQEK
NT seq 591 nt   +upstreamnt  +downstreamnt
atggaaattatttcatcaaaactattcattttattgactttagccacttcaagcttgtta
acatcaaacattttttgtgcagatgaattagtgatgtccaatcttcacagcaaagaaaat
tatgacaaatattctgagcctagaggatacccaaaaggggaaagaagcctcaattttgag
gaattaaaagattggggaccaaaaaatgttattaagatgagtacacctgcagtcaataaa
atgccacactccttcgccaacttgccattgagatttgggaggaacgttcaagaagaaaga
agtgctggagcaacagccaacctgcctctgagatctggaagaaatatggaggtgagcctc
gtgagacgtgttcctaacctgccccaaaggtttgggagaacaacaacagccaaaagtgtc
tgcaggatgctgagtgatttgtgtcaaggatccatgcattcaccatgtgccaatgactta
ttttactccatgacctgccagcaccaagaaatccagaatcccgatcaaaaacagtcaagg
agactgctattcaagaaaatagatgatgcagaattgaaacaagaaaaataa

KEGG   Homo sapiens (human): 8620
Entry
8620              CDS       T01001                                 
Symbol
NPFF, FMRFAL
Name
(RefSeq) neuropeptide FF-amide peptide precursor
  KO
K05247  neuropeptide FF-amide peptide
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    8620 (NPFF)
SSDB
Motif
Pfam: NPFF RBM1CTR
Other DBs
NCBI-GeneID: 8620
NCBI-ProteinID: NP_003708
OMIM: 604643
HGNC: 7901
Ensembl: ENSG00000139574
Pharos: O15130(Tbio)
CPD: C16111 C16112
UniProt: O15130
LinkDB
Position
12:complement(53506688..53507484)
AA seq 113 aa
MDSRQAAALLVLLLLIDGGCAEGPGGQQEDQLSAEEDSEPLPPQDAQTSGSLLHYLLQAM
ERPGRSQAFLFQPQRFGRNTQGSWRNEWLSPRAGEGLNSQFWSLAAPQRFGKK
NT seq 342 nt   +upstreamnt  +downstreamnt
atggattctaggcaggctgctgcactgctggtgctgctgctgttaatagacgggggctgt
gctgaagggccaggaggccagcaggaagaccagctctccgcggaggaagacagcgaaccc
ctcccaccacaggatgcccagacctctgggtcactgttgcactacctgctccaggcaatg
gagagacctggccggagccaagccttcctgtttcagccccagaggtttggcagaaatacc
cagggatcctggaggaatgaatggctgagtccccgggctggagaggggctgaattcccag
ttctggagcctggctgcccctcaacgctttgggaagaagtga

DBGET integrated database retrieval system