KEGG   Homo sapiens (human): 650
Entry
650               CDS       T01001                                 
Symbol
BMP2, BDA2, BMP2A, SSFSC, SSFSC1
Name
(RefSeq) bone morphogenetic protein 2
  KO
K21283  bone morphogenetic protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa05200  Pathways in cancer
hsa05217  Basal cell carcinoma
Network
nt06217  HH signaling
nt06269  Basal cell carcinoma
nt06507  TGFB signaling
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N01428  BMP signaling pathway, BMP antagonist
N01453  BMP signaling pathway
N01458  BMP-HAMP signaling pathway
Disease
H00482  Brachydactyly
H02481  Syndromic disorder with short stature
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    650 (BMP2)
   04390 Hippo signaling pathway
    650 (BMP2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    650 (BMP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    650 (BMP2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    650 (BMP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    650 (BMP2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    650 (BMP2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   650 (BMP2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Morphogens
   650 (BMP2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 650
NCBI-ProteinID: NP_001191
OMIM: 112261
HGNC: 1069
Ensembl: ENSG00000125845
Pharos: P12643(Tbio)
UniProt: P12643 C8C060
Structure
LinkDB
Position
20:6767686..6780246
AA seq 396 aa
MVAGTRCLLALLLPQVLLGGAAGLVPELGRRKFAAASSGRPSSQPSDEVLSEFELRLLSM
FGLKQRPTPSRDAVVPPYMLDLYRRHSGQPGSPAPDHRLERAASRANTVRSFHHEESLEE
LPETSGKTTRRFFFNLSSIPTEEFITSAELQVFREQMQDALGNNSSFHHRINIYEIIKPA
TANSKFPVTRLLDTRLVNQNASRWESFDVTPAVMRWTAQGHANHGFVVEVAHLEEKQGVS
KRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHP
LYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKAC
CVPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggtggccgggacccgctgtcttctagcgttgctgcttccccaggtcctcctgggcggc
gcggctggcctcgttccggagctgggccgcaggaagttcgcggcggcgtcgtcgggccgc
ccctcatcccagccctctgacgaggtcctgagcgagttcgagttgcggctgctcagcatg
ttcggcctgaaacagagacccacccccagcagggacgccgtggtgcccccctacatgcta
gacctgtatcgcaggcactcaggtcagccgggctcacccgccccagaccaccggttggag
agggcagccagccgagccaacactgtgcgcagcttccaccatgaagaatctttggaagaa
ctaccagaaacgagtgggaaaacaacccggagattcttctttaatttaagttctatcccc
acggaggagtttatcacctcagcagagcttcaggttttccgagaacagatgcaagatgct
ttaggaaacaatagcagtttccatcaccgaattaatatttatgaaatcataaaacctgca
acagccaactcgaaattccccgtgaccagacttttggacaccaggttggtgaatcagaat
gcaagcaggtgggaaagttttgatgtcacccccgctgtgatgcggtggactgcacaggga
cacgccaaccatggattcgtggtggaagtggcccacttggaggagaaacaaggtgtctcc
aagagacatgttaggataagcaggtctttgcaccaagatgaacacagctggtcacagata
aggccattgctagtaacttttggccatgatggaaaagggcatcctctccacaaaagagaa
aaacgtcaagccaaacacaaacagcggaaacgccttaagtccagctgtaagagacaccct
ttgtacgtggacttcagtgacgtggggtggaatgactggattgtggctcccccggggtat
cacgccttttactgccacggagaatgcccttttcctctggctgatcatctgaactccact
aatcatgccattgttcagacgttggtcaactctgttaactctaagattcctaaggcatgc
tgtgtcccgacagaactcagtgctatctcgatgctgtaccttgacgagaatgaaaaggtt
gtattaaagaactatcaggacatggttgtggagggttgtgggtgtcgctag

KEGG   Homo sapiens (human): 652
Entry
652               CDS       T01001                                 
Symbol
BMP4, BMP2B, BMP2B1, MCOPS6, OFC11, ZYME
Name
(RefSeq) bone morphogenetic protein 4
  KO
K04662  bone morphogenetic protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04919  Thyroid hormone signaling pathway
hsa05200  Pathways in cancer
hsa05217  Basal cell carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06217  HH signaling
nt06269  Basal cell carcinoma
nt06507  TGFB signaling
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N01428  BMP signaling pathway, BMP antagonist
N01453  BMP signaling pathway
Disease
H00516  Cleft lip and/or cleft palate
H02170  Microphthalmia, syndromic
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    652 (BMP4)
   04390 Hippo signaling pathway
    652 (BMP4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    652 (BMP4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    652 (BMP4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    652 (BMP4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    652 (BMP4)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    652 (BMP4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    652 (BMP4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    652 (BMP4)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    652 (BMP4)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   652 (BMP4)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Morphogens
   652 (BMP4)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 652
NCBI-ProteinID: NP_001193
OMIM: 112262
HGNC: 1071
Ensembl: ENSG00000125378
Pharos: P12644(Tchem)
UniProt: P12644 Q53XC5
LinkDB
Position
14:complement(53949736..53956891)
AA seq 408 aa
MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEAT
LLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIHSTGLEYPERPASRANTVRSF
HHEEHLENIPGTSENSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWERGFHRINI
YEVMKPPAEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTH
LHQTRTHQGQHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQR
ARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTL
VNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgattcctggtaaccgaatgctgatggtcgttttattatgccaagtcctgctaggaggc
gcgagccatgctagtttgatacctgagacggggaagaaaaaagtcgccgagattcagggc
cacgcgggaggacgccgctcagggcagagccatgagctcctgcgggacttcgaggcgaca
cttctgcagatgtttgggctgcgccgccgcccgcagcctagcaagagtgccgtcattccg
gactacatgcgggatctttaccggcttcagtctggggaggaggaggaagagcagatccac
agcactggtcttgagtatcctgagcgcccggccagccgggccaacaccgtgaggagcttc
caccacgaagaacatctggagaacatcccagggaccagtgaaaactctgcttttcgtttc
ctctttaacctcagcagcatccctgagaacgaggtgatctcctctgcagagcttcggctc
ttccgggagcaggtggaccagggccctgattgggaaaggggcttccaccgtataaacatt
tatgaggttatgaagcccccagcagaagtggtgcctgggcacctcatcacacgactactg
gacacgagactggtccaccacaatgtgacacggtgggaaacttttgatgtgagccctgcg
gtccttcgctggacccgggagaagcagccaaactatgggctagccattgaggtgactcac
ctccatcagactcggacccaccagggccagcatgtcaggattagccgatcgttacctcaa
gggagtgggaattgggcccagctccggcccctcctggtcacctttggccatgatggccgg
ggccatgccttgacccgacgccggagggccaagcgtagccctaagcatcactcacagcgg
gccaggaagaagaataagaactgccggcgccactcgctctatgtggacttcagcgatgtg
ggctggaatgactggattgtggccccaccaggctaccaggccttctactgccatggggac
tgcccctttccactggctgaccacctcaactcaaccaaccatgccattgtgcagaccctg
gtcaattctgtcaattccagtatccccaaagcctgttgtgtgcccactgaactgagtgcc
atctccatgctgtacctggatgagtatgataaggtggtactgaaaaattatcaggagatg
gtagtagagggatgtgggtgccgctga

KEGG   Homo sapiens (human): 64399
Entry
64399             CDS       T01001                                 
Symbol
HHIP, HIP
Name
(RefSeq) hedgehog interacting protein
  KO
K06231  hedgehog interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04340  Hedgehog signaling pathway
hsa05200  Pathways in cancer
hsa05217  Basal cell carcinoma
Network
nt06217  HH signaling
nt06269  Basal cell carcinoma
nt06501  HH signaling
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00062  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    64399 (HHIP)
   04024 cAMP signaling pathway
    64399 (HHIP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    64399 (HHIP)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    64399 (HHIP)
SSDB
Motif
Pfam: Folate_rec GSDH EGF_2
Other DBs
NCBI-GeneID: 64399
NCBI-ProteinID: NP_071920
OMIM: 606178
HGNC: 14866
Ensembl: ENSG00000164161
Pharos: Q96QV1(Tbio)
UniProt: Q96QV1
Structure
LinkDB
Position
4:144646156..144745271
AA seq 700 aa
MLKMLSFKLLLLAVALGFFEGDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLE
LLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ
SLFHSPEREVLERDLVLPLLCKDYCKEFFYTCRGHIPGFLQTTADEFCFYYARKDGGLCF
PDFPRKQVRGPASNYLDQMEEYDKVEEISRKHKHNCFCIQEVVSGLRQPVGALHSGDGSQ
RLFILEKEGYVKILTPEGEIFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLY
VSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHRKHLGGQLLFG
PDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQ
PPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGKDYESEPSL
LEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGTS
GSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRATVQP
AQTLTSECSRLCRNGYCTPTGKCCCSPGWEGDFCRTAKCEPACRHGGVCVRPNKCLCKKG
YLGPQCEQVDRNIRRVTRAGILDQIIDMTSYLLDLTSYIV
NT seq 2103 nt   +upstreamnt  +downstreamnt
atgctgaagatgctctcctttaagctgctgctgctggccgtggctctgggcttctttgaa
ggagatgctaagtttggggaaagaaacgaagggagcggagcaaggaggagaaggtgcctg
aatgggaaccccccgaagcgcctgaaaaggagagacaggaggatgatgtcccagctggag
ctgctgagtgggggagagatgctgtgcggtggcttctaccctcggctgtcctgctgcctg
cggagtgacagcccggggctagggcgcctggagaataagatattttctgttaccaacaac
acagaatgtgggaagttactggaggaaatcaaatgtgcactttgctctccacattctcaa
agcctgttccactcacctgagagagaagtcttggaaagagacctagtacttcctctgctc
tgcaaagactattgcaaagaattcttttacacttgccgaggccatattccaggtttcctt
caaacaactgcggatgagttttgcttttactatgcaagaaaagatggtgggttgtgcttt
ccagattttccaagaaaacaagtcagaggaccagcatctaactacttggaccagatggaa
gaatatgacaaagtggaagagatcagcagaaagcacaaacacaactgcttctgtattcag
gaggttgtgagtgggctgcggcagcccgttggtgccctgcatagtggggatggctcgcaa
cgtctcttcattctggaaaaagaaggttatgtgaagatacttacccctgaaggagaaatt
ttcaaggagccttatttggacattcacaaacttgttcaaagtggaataaagggaggagat
gaaagaggactgctaagcctcgcattccatcccaattacaagaaaaatggaaagttgtat
gtgtcctataccaccaaccaagaacggtgggctatcgggcctcatgaccacattcttagg
gttgtggaatacacagtatccagaaaaaatccacaccaagttgatttgagaacagccaga
gtctttcttgaagttgcagaactccacagaaagcatctgggaggacaactgctctttggc
cctgacggctttttgtacatcattcttggtgatgggatgattacactggatgatatggaa
gaaatggatgggttaagtgatttcacaggctcagtgctacggctggatgtggacacagac
atgtgcaacgtgccttattccataccaaggagcaacccacacttcaacagcaccaaccag
ccccccgaagtgtttgctcatgggctccacgatccaggcagatgtgctgtggatagacat
cccactgatataaacatcaatttaacgatactgtgttcagactccaatggaaaaaacaga
tcatcagccagaattctacagataataaaggggaaagattatgaaagtgagccatcactt
ttagaattcaagccattcagtaatggtcctttggttggtggatttgtataccggggctgc
cagtcagaaagattgtatggaagctacgtgtttggagatcgtaatgggaatttcctaact
ctccagcaaagtcctgtgacaaagcagtggcaagaaaaaccactctgtctcggcactagt
gggtcctgtagaggctacttttccggtcacatcttgggatttggagaagatgaactaggt
gaagtttacattttatcaagcagtaaaagtatgacccagactcacaatggaaaactctac
aaaattgtagatcccaaaagacctttaatgcctgaggaatgcagagccacggtacaacct
gcacagacactgacttcagagtgctccaggctctgtcgaaacggctactgcacccccacg
ggaaagtgctgctgcagtccaggctgggagggggacttctgcagaactgcaaaatgtgag
ccagcatgtcgtcatggaggtgtctgtgttagaccgaacaagtgcctctgtaaaaaagga
tatcttggtcctcaatgtgaacaagtggacagaaacatccgcagagtgaccagggcaggt
attcttgatcagatcattgacatgacatcttacttgctggatctaacaagttacattgta
tag

KEGG   Homo sapiens (human): 2735
Entry
2735              CDS       T01001                                 
Symbol
GLI1, GLI, PAPA8, PPD1
Name
(RefSeq) GLI family zinc finger 1
  KO
K16797  zinc finger protein GLI1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04340  Hedgehog signaling pathway
hsa05200  Pathways in cancer
hsa05217  Basal cell carcinoma
Network
nt06217  HH signaling
nt06269  Basal cell carcinoma
nt06501  HH signaling
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00062  Hedgehog signaling pathway
Disease
H01852  Postaxial polydactyly
H02332  Preaxial polydactyly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    2735 (GLI1)
   04024 cAMP signaling pathway
    2735 (GLI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2735 (GLI1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    2735 (GLI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2735 (GLI1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    2735 (GLI1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4 IL17
Other DBs
NCBI-GeneID: 2735
NCBI-ProteinID: NP_005260
OMIM: 165220
HGNC: 4317
Ensembl: ENSG00000111087
Pharos: P08151(Tchem)
UniProt: P08151
Structure
LinkDB
Position
12:57459785..57472268
AA seq 1106 aa
MFNSMTPPPISSYGEPCCLRPLPSQGAPSVGTEGLSGPPFCHQANLMSGPHSYGPARETN
SCTEGPLFSSPRSAVKLTKKRALSISPLSDASLDLQTVIRTSPSSLVAFINSRCTSPGGS
YGHLSIGTMSPSLGFPAQMNHQKGPSPSFGVQPCGPHDSARGGMIPHPQSRGPFPTCQLK
SELDMLVGKCREEPLEGDMSSPNSTGIQDPLLGMLDGREDLEREEKREPESVYETDCRWD
GCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKP
HKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEK
PYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRAPSISTVEPKREREG
GPIREESRLTVPEGAMKPQPSPGAQSSCSSDHSPAGSAANTDSGVEMTGNAGGSTEDLSS
LDEGPCIAGTGLSTLRRLENLRLDQLHQLRPIGTRGLKLPSLSHTGTTVSRRVGPPVSLE
RRSSSSSSISSAYTVSRRSSLASPFPPGSPPENGASSLPGLMPAQHYLLRARYASARGGG
TSPTAASSLDRIGGLPMPPWRSRAEYPGYNPNAGVTRRASDPAQAADRPAPARVQRFKSL
GCVHTPPTVAGGGQNFDPYLPTSVYSPQPPSITENAAMDARGLQEEPEVGTSMVGSGLNP
YMDFPPTDTLGYGGPEGAAAEPYGARGPGSLPLGPGPPTNYGPNPCPQQASYPDPTQETW
GEFPSHSGLYPGPKALGGTYSQCPRLEHYGQVQVKPEQGCPVGSDSTGLAPCLNAHPSEG
PPHPQPLFSHYPQPSPPQYLQSGPYTQPPPDYLPSEPRPCLDFDSPTHSTGQLKAQLVCN
YVQSQQELLWEGGGREDAPAQEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHK
SGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLG
GGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGP
PNMAVGNMSVLLRSLPGETEFLNSSA
NT seq 3321 nt   +upstreamnt  +downstreamnt
atgttcaactcgatgaccccaccaccaatcagtagctatggcgagccctgctgtctccgg
cccctccccagtcagggggcccccagtgtggggacagaaggactgtctggcccgcccttc
tgccaccaagctaacctcatgtccggcccccacagttatgggccagccagagagaccaac
agctgcaccgagggcccactcttttcttctccccggagtgcagtcaagttgaccaagaag
cgggcactgtccatctcacctctgtcggatgccagcctggacctgcagacggttatccgc
acctcacccagctccctcgtagctttcatcaactcgcgatgcacatctccaggaggctcc
tacggtcatctctccattggcaccatgagcccatctctgggattcccagcccagatgaat
caccaaaaagggccctcgccttcctttggggtccagccttgtggtccccatgactctgcc
cggggtgggatgatcccacatcctcagtcccggggacccttcccaacttgccagctgaag
tctgagctggacatgctggttggcaagtgccgggaggaacccttggaaggtgatatgtcc
agccccaactccacaggcatacaggatcccctgttggggatgctggatgggcgggaggac
ctcgagagagaggagaagcgtgagcctgaatctgtgtatgaaactgactgccgttgggat
ggctgcagccaggaatttgactcccaagagcagctggtgcaccacatcaacagcgagcac
atccacggggagcggaaggagttcgtgtgccactgggggggctgctccagggagctgagg
cccttcaaagcccagtacatgctggtggttcacatgcgcagacacactggcgagaagcca
cacaagtgcacgtttgaagggtgccggaagtcatactcacgcctcgaaaacctgaagacg
cacctgcggtcacacacgggtgagaagccatacatgtgtgagcacgagggctgcagtaaa
gccttcagcaatgccagtgaccgagccaagcaccagaatcggacccattccaatgagaag
ccgtatgtatgtaagctccctggctgcaccaaacgctatacagatcctagctcgctgcga
aaacatgtcaagacagtgcatggtcctgacgcccatgtgaccaaacggcaccgtggggat
ggccccctgcctcgggcaccatccatttctacagtggagcccaagagggagcgggaagga
ggtcccatcagggaggaaagcagactgactgtgccagagggtgccatgaagccacagcca
agccctggggcccagtcatcctgcagcagtgaccactccccggcagggagtgcagccaat
acagacagtggtgtggaaatgactggcaatgcagggggcagcactgaagacctctccagc
ttggacgagggaccttgcattgctggcactggtctgtccactcttcgccgccttgagaac
ctcaggctggaccagctacatcaactccggccaatagggacccggggtctcaaactgccc
agcttgtcccacaccggtaccactgtgtcccgccgcgtgggccccccagtctctcttgaa
cgccgcagcagcagctccagcagcatcagctctgcctatactgtcagccgccgctcctcc
ctggcctctcctttcccccctggctccccaccagagaatggagcatcctccctgcctggc
cttatgcctgcccagcactacctgcttcgggcaagatatgcttcagccagagggggtggt
acttcgcccactgcagcatccagcctggatcggataggtggtcttcccatgcctccttgg
agaagccgagccgagtatccaggatacaaccccaatgcaggggtcacccggagggccagt
gacccagcccaggctgctgaccgtcctgctccagctagagtccagaggttcaagagcctg
ggctgtgtccataccccacccactgtggcagggggaggacagaactttgatccttacctc
ccaacctctgtctactcaccacagccccccagcatcactgagaatgctgccatggatgct
agagggctacaggaagagccagaagttgggacctccatggtgggcagtggtctgaacccc
tatatggacttcccacctactgatactctgggatatgggggacctgaaggggcagcagct
gagccttatggagcgaggggtccaggctctctgcctcttgggcctggtccacccaccaac
tatggccccaacccctgtccccagcaggcctcatatcctgaccccacccaagaaacatgg
ggtgagttcccttcccactctgggctgtacccaggccccaaggctctaggtggaacctac
agccagtgtcctcgacttgaacattatggacaagtgcaagtcaagccagaacaggggtgc
ccagtggggtctgactccacaggactggcaccctgcctcaatgcccaccccagtgagggg
cccccacatccacagcctctcttttcccattacccccagccctctcctccccaatatctc
cagtcaggcccctatacccagccaccccctgattatcttccttcagaacccaggccttgc
ctggactttgattcccccacccattccacagggcagctcaaggctcagcttgtgtgtaat
tatgttcaatctcaacaggagctactgtgggagggtgggggcagggaagatgcccccgcc
caggaaccttcctaccagagtcccaagtttctggggggttcccaggttagcccaagccgt
gctaaagctccagtgaacacatatggacctggctttggacccaacttgcccaatcacaag
tcaggttcctatcccaccccttcaccatgccatgaaaattttgtagtgggggcaaatagg
gcttcacatagggcagcagcaccacctcgacttctgcccccattgcccacttgctatggg
cctctcaaagtgggaggcacaaaccccagctgtggtcatcctgaggtgggcaggctagga
gggggtcctgccttgtaccctcctcccgaaggacaggtatgtaaccccctggactctctt
gatcttgacaacactcagctggactttgtggctattctggatgagccccaggggctgagt
cctcctccttcccatgatcagcggggcagctctggacataccccacctccctctgggccc
cccaacatggctgtgggcaacatgagtgtcttactgagatccctacctggggaaacagaa
ttcctcaactctagtgcctaa

KEGG   Homo sapiens (human): 5727
Entry
5727              CDS       T01001                                 
Symbol
PTCH1, BCNS, NBCCS, PTC, PTC1, PTCH
Name
(RefSeq) patched 1
  KO
K06225  patched 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04340  Hedgehog signaling pathway
hsa04360  Axon guidance
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
Network
nt06217  HH signaling
nt06269  Basal cell carcinoma
nt06501  HH signaling
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00062  Hedgehog signaling pathway
N01538  Hedgehog signaling pathway, PTCH coreceptor
Disease
H00039  Basal cell carcinoma
H00267  Holoprosencephaly
H00895  Basal cell nevus syndrome
H01667  Medulloblastoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    5727 (PTCH1)
   04024 cAMP signaling pathway
    5727 (PTCH1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    5727 (PTCH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5727 (PTCH1)
   05205 Proteoglycans in cancer
    5727 (PTCH1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    5727 (PTCH1)
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 5727
NCBI-ProteinID: NP_000255
OMIM: 601309
HGNC: 9585
Ensembl: ENSG00000185920
Pharos: Q13635(Tbio)
UniProt: Q13635
Structure
LinkDB
Position
9:complement(95442980..95516971)
AA seq 1447 aa
MASAGNAAEPQDRGGGGSGCIGAPGRPAGGGRRRRTGGLRRAAAPDRDYLHRPSYCDAAF
ALEQISKGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAAN
LETNVEELWVEVGGRVSRELNYTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALLQHLD
SALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCLIITPLDCFWEGAK
LQSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLNPA
DPDCPATAPNKNSTKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHAL
QTMFQLMTPKQMYEHFKGYEYVSHINWNEDKAAAILEAWQRTYVEVVHQSVAQNSTQKVL
SFTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALS
VAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGEC
LKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDL
YRREDRRLDIFCCFTSPCVSRVIQVEPQAYTDTHDNTRYSPPPPYSSHSFAHETQITMQS
TVQLRTEYDPHTHVYYTTAEPRSEISVQPVTVTQDTLSCQSPESTSSTRDLLSQFSDSSL
HCLEPPCTKWTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTDI
VPRETREYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHRSFSNVKYVMLEENKQL
PKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDIS
QLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDKADYMPETR
LRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNYTSLGLSSYPNGYPFLFWEQ
YIGLRHWLLLFISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSA
VPVVILIASVGIGVEFTVHVALAFLTAIGDKNRRAVLALEHMFAPVLDGAVSTLLGVLML
AGSEFDFIVRYFFAVLAILTILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEP
PPSVVRFAMPPGHTHSGSDSSDSEYSSQTTVSGLSEELRHYEAQQGAGGPAHQVIVEATE
NPVFAHSTVVHPESRHHPPSNPRQQPHLDSGSLPPGRQGQQPRRDPPREGLWPPPYRPRR
DAFEISTEGHSGPSNRARWGPRGARSHNPRNPASTAMGSSVPGYCQPITTVTASASVTVA
VHPPPVPGPGRNPRGGLCPGYPETDHGLFEDPHVPFHVRCERRDSKVEVIELQDVECEER
PRGSSSN
NT seq 4344 nt   +upstreamnt  +downstreamnt
atggcctcggctggtaacgccgccgagccccaggaccgcggcggcggcggcagcggctgt
atcggtgccccgggacggccggctggaggcgggaggcgcagacggacgggggggctgcgc
cgtgctgccgcgccggaccgggactatctgcaccggcccagctactgcgacgccgccttc
gctctggagcagatttccaaggggaaggctactggccggaaagcgccgctgtggctgaga
gcgaagtttcagagactcttatttaaactgggttgttacattcaaaaaaactgcggcaag
ttcttggttgtgggcctcctcatatttggggccttcgcggtgggattaaaagcagcgaac
ctcgagaccaacgtggaggagctgtgggtggaagttggaggacgagtaagtcgtgaatta
aattatactcgccagaagattggagaagaggctatgtttaatcctcaactcatgatacag
acccctaaagaagaaggtgctaatgtcctgaccacagaagcgctcctacaacacctggac
tcggcactccaggccagccgtgtccatgtatacatgtacaacaggcagtggaaattggaa
catttgtgttacaaatcaggagagcttatcacagaaacaggttacatggatcagataata
gaatatctttacccttgtttgattattacacctttggactgcttctgggaaggggcgaaa
ttacagtctgggacagcatacctcctaggtaaacctcctttgcggtggacaaacttcgac
cctttggaattcctggaagagttaaagaaaataaactatcaagtggacagctgggaggaa
atgctgaataaggctgaggttggtcatggttacatggaccgcccctgcctcaatccggcc
gatccagactgccccgccacagcccccaacaaaaattcaaccaaacctcttgatatggcc
cttgttttgaatggtggatgtcatggcttatccagaaagtatatgcactggcaggaggag
ttgattgtgggtggcacagtcaagaacagcactggaaaactcgtcagcgcccatgccctg
cagaccatgttccagttaatgactcccaagcaaatgtacgagcacttcaaggggtacgag
tatgtctcacacatcaactggaacgaggacaaagcggcagccatcctggaggcctggcag
aggacatatgtggaggtggttcatcagagtgtcgcacagaactccactcaaaaggtgctt
tccttcaccaccacgaccctggacgacatcctgaaatccttctctgacgtcagtgtcatc
cgcgtggccagcggctacttactcatgctcgcctatgcctgtctaaccatgctgcgctgg
gactgctccaagtcccagggtgccgtggggctggctggcgtcctgctggttgcactgtca
gtggctgcaggactgggcctgtgctcattgatcggaatttcctttaacgctgcaacaact
caggttttgccatttctcgctcttggtgttggtgtggatgatgtttttcttctggcccac
gccttcagtgaaacaggacagaataaaagaatcccttttgaggacaggaccggggagtgc
ctgaagcgcacaggagccagcgtggccctcacgtccatcagcaatgtcacagccttcttc
atggccgcgttaatcccaattcccgctctgcgggcgttctccctccaggcagcggtagta
gtggtgttcaattttgccatggttctgctcatttttcctgcaattctcagcatggattta
tatcgacgcgaggacaggagactggatattttctgctgttttacaagcccctgcgtcagc
agagtgattcaggttgaacctcaggcctacaccgacacacacgacaatacccgctacagc
cccccacctccctacagcagccacagctttgcccatgaaacgcagattaccatgcagtcc
actgtccagctccgcacggagtacgacccccacacgcacgtgtactacaccaccgctgag
ccgcgctccgagatctctgtgcagcccgtcaccgtgacacaggacaccctcagctgccag
agcccagagagcaccagctccacaagggacctgctctcccagttctccgactccagcctc
cactgcctcgagcccccctgtacgaagtggacactctcatcttttgctgagaagcactat
gctcctttcctcttgaaaccaaaagccaaggtagtggtgatcttcctttttctgggcttg
ctgggggtcagcctttatggcaccacccgagtgagagacgggctggaccttacggacatt
gtacctcgggaaaccagagaatatgactttattgctgcacaattcaaatacttttctttc
tacaacatgtatatagtcacccagaaagcagactacccgaatatccagcacttactttac
gacctacacaggagtttcagtaacgtgaagtatgtcatgttggaagaaaacaaacagctt
cccaaaatgtggctgcactacttcagagactggcttcagggacttcaggatgcatttgac
agtgactgggaaaccgggaaaatcatgccaaacaattacaagaatggatcagacgatgga
gtccttgcctacaaactcctggtgcaaaccggcagccgcgataagcccatcgacatcagc
cagttgactaaacagcgtctggtggatgcagatggcatcattaatcccagcgctttctac
atctacctgacggcttgggtcagcaacgaccccgtcgcgtatgctgcctcccaggccaac
atccggccacaccgaccagaatgggtccacgacaaagccgactacatgcctgaaacaagg
ctgagaatcccggcagcagagcccatcgagtatgcccagttccctttctacctcaacggc
ttgcgggacacctcagactttgtggaggcaattgaaaaagtaaggaccatctgcagcaac
tatacgagcctggggctgtccagttaccccaacggctaccccttcctcttctgggagcag
tacatcggcctccgccactggctgctgctgttcatcagcgtggtgttggcctgcacattc
ctcgtgtgcgctgtcttccttctgaacccctggacggccgggatcattgtgatggtcctg
gcgctgatgacggtcgagctgttcggcatgatgggcctcatcggaatcaagctcagtgcc
gtgcccgtggtcatcctgatcgcttctgttggcataggagtggagttcaccgttcacgtt
gctttggcctttctgacggccatcggcgacaagaaccgcagggctgtgcttgccctggag
cacatgtttgcacccgtcctggatggcgccgtgtccactctgctgggagtgctgatgctg
gcgggatctgagttcgacttcattgtcaggtatttctttgctgtgctggcgatcctcacc
atcctcggcgttctcaatgggctggttttgcttcccgtgcttttgtctttctttggacca
tatcctgaggtgtctccagccaacggcttgaaccgcctgcccacaccctcccctgagcca
ccccccagcgtggtccgcttcgccatgccgcccggccacacgcacagcgggtctgattcc
tccgactcggagtatagttcccagacgacagtgtcaggcctcagcgaggagcttcggcac
tacgaggcccagcagggcgcgggaggccctgcccaccaagtgatcgtggaagccacagaa
aaccccgtcttcgcccactccactgtggtccatcccgaatccaggcatcacccaccctcg
aacccgagacagcagccccacctggactcagggtccctgcctcccggacggcaaggccag
cagccccgcagggacccccccagagaaggcttgtggccacccccctacagaccgcgcaga
gacgcttttgaaatttctactgaagggcattctggccctagcaatagggcccgctggggc
cctcgcggggcccgttctcacaaccctcggaacccagcgtccactgccatgggcagctcc
gtgcccggctactgccagcccatcaccactgtgacggcttctgcctccgtgactgtcgcc
gtgcacccgccgcctgtccctgggcctgggcggaacccccgagggggactctgcccaggc
taccctgagactgaccacggcctgtttgaggacccccacgtgcctttccacgtccggtgt
gagaggagggattcgaaggtggaagtcattgagctgcaggacgtggaatgcgaggagagg
ccccggggaagcagctccaactga

KEGG   Homo sapiens (human): 8643
Entry
8643              CDS       T01001                                 
Symbol
PTCH2, PTC2
Name
(RefSeq) patched 2
  KO
K11101  patched 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
hsa05200  Pathways in cancer
hsa05217  Basal cell carcinoma
Network
nt06217  HH signaling
nt06269  Basal cell carcinoma
nt06501  HH signaling
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00062  Hedgehog signaling pathway
N01538  Hedgehog signaling pathway, PTCH coreceptor
Disease
H00039  Basal cell carcinoma
H00895  Basal cell nevus syndrome
H01667  Medulloblastoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    8643 (PTCH2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    8643 (PTCH2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    8643 (PTCH2)
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 8643
NCBI-ProteinID: NP_003729
OMIM: 603673
HGNC: 9586
Ensembl: ENSG00000117425
Pharos: Q9Y6C5(Tbio)
UniProt: Q9Y6C5
LinkDB
Position
1:complement(44819845..44843253)
AA seq 1203 aa
MTRSPPLRELPPSYTPPARTAAPQILAGSLKAPLWLRAYFQGLLFSLGCGIQRHCGKVLF
LGLLAFGALALGLRMAIIETNLEQLWVEVGSRVSQELHYTKEKLGEEAAYTSQMLIQTAR
QEGENILTPEALGLHLQAALTASKVQVSLYGKSWDLNKICYKSGVPLIENGMIERMIEKL
FPCVILTPLDCFWEGAKLQGGSAYLPGRPDIQWTNLDPEQLLEELGPFASLEGFRELLDK
AQVGQAYVGRPCLHPDDLHCPPSAPNHHSRQAPNVAHELSGGCHGFSHKFMHWQEELLLG
GMARDPQGELLRAEALQSTFLLMSPRQLYEHFRGDYQTHDIGWSEEQASTVLQAWQRRFV
QLAQEALPENASQQIHAFSSTTLDDILHAFSEVSAARVVGGYLLMLAYACVTMLRWDCAQ
SQGSVGLAGVLLVALAVASGLGLCALLGITFNAATTQVLPFLALGIGVDDVFLLAHAFTE
ALPGTPLQERMGECLQRTGTSVVLTSINNMAAFLMAALVPIPALRAFSLQAAIVVGCTFV
AVMLVFPAILSLDLRRRHCQRLDVLCCFSSPCSAQVIQILPQELGDGTVPVGIAHLTATV
QAFTHCEASSQHVVTILPPQAHLVPPPSDPLGSELFSPGGSTRDLLGQEEETRQKAACKS
LPCARWNLAHFARYQFAPLLLQSHAKAIVLVLFGALLGLSLYGATLVQDGLALTDVVPRG
TKEHAFLSAQLRYFSLYEVALVTQGGFDYAHSQRALFDLHQRFSSLKAVLPPPATQAPRT
WLHYYRNWLQGIQAAFDQDWASGRITRHSYRNGSEDGALAYKLLIQTGDAQEPLDFSQLT
TRKLVDREGLIPPELFYMGLTVWVSSDPLGLAASQANFYPPPPEWLHDKYDTTGENLRIP
PAQPLEFAQFPFLLRGLQKTADFVEAIEGARAACAEAGQAGVHAYPSGSPFLFWEQYLGL
RRCFLLAVCILLVCTFLVCALLLLNPWTAGLIVLVLAMMTVELFGIMGFLGIKLSAIPVV
ILVASVGIGVEFTVHVALGFLTTQGSRNLRAAHALEHTFAPVTDGAISTLLGLLMLAGSH
FDFIVRYFFAALTVLTLLGLLHGLVLLPVLLSILGPPPEVIQMYKESPEILSPPAPQGGG
LRWGASSSLPQSFARVTTSMTVAIHPPPLPGAYIHPAPDEPPWSPAATSSGNLSSRGPGP
ATG
NT seq 3612 nt   +upstreamnt  +downstreamnt
atgactcgatcgccgcccctcagagagctgcccccgagttacacacccccagctcgaacc
gcagcaccccagatcctagctgggagcctgaaggctccactctggcttcgtgcttacttc
cagggcctgctcttctctctgggatgcgggatccagagacattgtggcaaagtgctcttt
ctgggactgttggcctttggggccctggcattaggtctccgcatggccattattgagaca
aacttggaacagctctgggtagaagtgggcagccgggtgagccaggagctgcattacacc
aaggagaagctgggggaggaggctgcatacacctctcagatgctgatacagaccgcacgc
caggagggagagaacatcctcacacccgaagcacttggcctccacctccaggcagccctc
actgccagtaaagtccaagtatcactctatgggaagtcctgggatttgaacaaaatctgc
tacaagtcaggagttccccttattgaaaatggaatgattgagcggatgattgagaagctg
tttccgtgcgtgatcctcacccccctcgactgcttctgggagggagccaaactccaaggg
ggctccgcctacctgcccggccgcccggatatccagtggaccaacctggatccagagcag
ctgctggaggagctgggtccctttgcctcccttgagggcttccgggagctgctagacaag
gcacaggtgggccaggcctacgtggggcggccctgtctgcaccctgatgacctccactgc
ccacctagtgcccccaaccatcacagcaggcaggctcccaatgtggctcacgagctgagt
gggggctgccatggcttctcccacaaattcatgcactggcaggaggaattgctgctggga
ggcatggccagagacccccaaggagagctgctgagggcagaggccctgcagagcaccttc
ttgctgatgagtccccgccagctgtacgagcatttccggggtgactatcagacacatgac
attggctggagtgaggagcaggccagcacagtgctacaagcctggcagcggcgctttgtg
cagctggcccaggaggccctgcctgagaacgcttcccagcagatccatgccttctcctcc
accaccctggatgacatcctgcatgcgttctctgaagtcagtgctgcccgtgtggtggga
ggctatctgctcatgctggcctatgcctgtgtgaccatgctgcggtgggactgcgcccag
tcccagggttccgtgggccttgccggggtactgctggtggccctggcggtggcctcaggc
cttgggctctgtgccctgctcggcatcaccttcaatgctgccactacccaggtgctgccc
ttcttggctctgggaatcggcgtggatgacgtattcctgctggcgcatgccttcacagag
gctctgcctggcacccctctccaggagcgcatgggcgagtgtctgcagcgcacgggcacc
agtgtcgtactcacatccatcaacaacatggccgccttcctcatggctgccctcgttccc
atccctgcgctgcgagccttctccctacaggcggccatagtggttggctgcacctttgta
gccgtgatgcttgtcttcccagccatcctcagcctggacctacggcggcgccactgccag
cgccttgatgtgctctgctgcttctccagtccctgctctgctcaggtgattcagatcctg
ccccaggagctgggggacgggacagtaccagtgggcattgcccacctcactgccacagtt
caagcctttacccactgtgaagccagcagccagcatgtggtcaccatcctgcctccccaa
gcccacctggtgcccccaccttctgacccactgggctctgagctcttcagccctggaggg
tccacacgggaccttctaggccaggaggaggagacaaggcagaaggcagcctgcaagtcc
ctgccctgtgcccgctggaatcttgcccatttcgcccgctatcagtttgccccgttgctg
ctccagtcacatgctaaggccatcgtgctggtgctctttggtgctcttctgggcctgagc
ctctacggagccaccttggtgcaagacggcctggccctgacggatgtggtgcctcggggc
accaaggagcatgccttcctgagcgcccagctcaggtacttctccctgtacgaggtggcc
ctggtgacccagggtggctttgactacgcccactcccaacgcgccctctttgatctgcac
cagcgcttcagttccctcaaggcggtgctgcccccaccggccacccaggcaccccgcacc
tggctgcactattaccgcaactggctacagggaatccaggctgcctttgaccaggactgg
gcttctgggcgcatcacccgccactcgtaccgcaatggctctgaggatggggccctggcc
tacaagctgctcatccagactggagacgcccaggagcctctggatttcagccagctgacc
acaaggaagctggtggacagagagggactgattccacccgagctcttctacatggggctg
accgtgtgggtgagcagtgaccccctgggtctggcagcctcacaggccaacttctacccc
ccacctcctgaatggctgcacgacaaatacgacaccacgggggagaaccttcgcatcccg
ccagctcagcccttggagtttgcccagttccccttcctgctgcgtggcctccagaagact
gcagactttgtggaggccatcgagggggcccgggcagcatgcgcagaggccggccaggct
ggggtgcacgcctaccccagcggctcccccttcctcttctgggaacagtatctgggcctg
cggcgctgcttcctgctggccgtctgcatcctgctggtgtgcactttcctcgtctgtgct
ctgctgctcctcaacccctggacggctggcctcatagtgctggtcctggcgatgatgaca
gtggaactctttggtatcatgggtttcctgggcatcaagctgagtgccatccccgtggtg
atccttgtggcctctgtaggcattggcgttgagttcacagtccacgtggctctgggcttc
ctgaccacccagggcagccggaacctgcgggccgcccatgcccttgagcacacatttgcc
cccgtgaccgatggggccatctccacattgctgggtctgctcatgcttgctggttcccac
tttgacttcattgtaaggtacttctttgcggcgctgacagtgctcacgctcctgggcctc
ctccatggactcgtgctgctgcctgtgctgctgtccatcctgggcccgccgccagaggtg
atacagatgtacaaggaaagcccagagatcctgagtccaccagctccacagggaggcggg
cttaggtggggggcatcctcctccctgccccagagctttgccagagtgactacctccatg
accgtggccatccacccaccccccctgcctggtgcctacatccatccagcccctgatgag
cccccttggtcccctgctgccactagctctggcaacctcagttccaggggaccaggtcca
gccactgggtga

KEGG   Homo sapiens (human): 7471
Entry
7471              CDS       T01001                                 
Symbol
WNT1, BMND16, INT1, OI15
Name
(RefSeq) Wnt family member 1
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06227  Nuclear receptor signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
nt06505  WNT signaling
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N01363  P4/MPA to nuclear-initiated progesterone signaling pathway
N01442  Wnt signaling modulation, Wnt inhibitor
N01443  Wnt signaling modulation, Wnt acylation
Disease
H00506  Osteogenesis imperfecta
H01593  Osteoporosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7471 (WNT1)
   04390 Hippo signaling pathway
    7471 (WNT1)
   04150 mTOR signaling pathway
    7471 (WNT1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7471 (WNT1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7471 (WNT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7471 (WNT1)
   05205 Proteoglycans in cancer
    7471 (WNT1)
   05207 Chemical carcinogenesis - receptor activation
    7471 (WNT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7471 (WNT1)
   05226 Gastric cancer
    7471 (WNT1)
   05217 Basal cell carcinoma
    7471 (WNT1)
   05224 Breast cancer
    7471 (WNT1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7471 (WNT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    7471 (WNT1)
   05022 Pathways of neurodegeneration - multiple diseases
    7471 (WNT1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7471 (WNT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7471 (WNT1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Morphogens
   7471 (WNT1)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 7471
NCBI-ProteinID: NP_005421
OMIM: 164820
HGNC: 12774
Ensembl: ENSG00000125084
Pharos: P04628(Tbio)
UniProt: P04628
LinkDB
Position
12:48978322..48982620
AA seq 370 aa
MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggggctctgggcgctgttgcctggctgggtttctgctacgctgctgctggcgctggcc
gctctgcccgcagccctggctgccaacagcagtggccgatggtggggtattgtgaacgta
gcctcctccacgaacctgcttacagactccaagagtctgcaactggtactcgagcccagt
ctgcagctgttgagccgcaaacagcggcgtctgatacgccaaaatccggggatcctgcac
agcgtgagtggggggctgcagagtgccgtgcgcgagtgcaagtggcagttccggaatcgc
cgctggaactgtcccactgctccagggccccacctcttcggcaagatcgtcaaccgaggc
tgtcgagaaacggcgtttatcttcgctatcacctccgccggggtcacccattcggtggcg
cgctcctgctcagaaggttccatcgaatcctgcacgtgtgactaccggcggcgcggcccc
gggggccccgactggcactgggggggctgcagcgacaacattgacttcggccgcctcttc
ggccgggagttcgtggactccggggagaaggggcgggacctgcgcttcctcatgaacctt
cacaacaacgaggcaggccgtacgaccgtattctccgagatgcgccaggagtgcaagtgc
cacgggatgtccggctcatgcacggtgcgcacgtgctggatgcggctgcccacgctgcgc
gccgtgggcgatgtgctgcgcgaccgcttcgacggcgcctcgcgcgtcctgtacggcaac
cgcggcagcaaccgcgcttcgcgggcggagctgctgcgcctggagccggaagacccggcc
cacaaaccgccctccccccacgacctcgtctacttcgagaaatcgcccaacttctgcacg
tacagcggacgcctgggcacagcaggcacggcagggcgcgcctgtaacagctcgtcgccc
gcgctggacggctgcgagctgctctgctgcggcaggggccaccgcacgcgcacgcagcgc
gtcaccgagcgctgcaactgcaccttccactggtgctgccacgtcagctgccgcaactgc
acgcacacgcgcgtactgcacgagtgtctgtga

KEGG   Homo sapiens (human): 7472
Entry
7472              CDS       T01001                                 
Symbol
WNT2, INT1L1, IRP
Name
(RefSeq) Wnt family member 2
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
nt06505  WNT signaling
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N01442  Wnt signaling modulation, Wnt inhibitor
N01443  Wnt signaling modulation, Wnt acylation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7472 (WNT2)
   04390 Hippo signaling pathway
    7472 (WNT2)
   04150 mTOR signaling pathway
    7472 (WNT2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7472 (WNT2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7472 (WNT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7472 (WNT2)
   05205 Proteoglycans in cancer
    7472 (WNT2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7472 (WNT2)
   05226 Gastric cancer
    7472 (WNT2)
   05217 Basal cell carcinoma
    7472 (WNT2)
   05224 Breast cancer
    7472 (WNT2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7472 (WNT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    7472 (WNT2)
   05022 Pathways of neurodegeneration - multiple diseases
    7472 (WNT2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7472 (WNT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7472 (WNT2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Morphogens
   7472 (WNT2)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 7472
NCBI-ProteinID: NP_003382
OMIM: 147870
HGNC: 12780
Ensembl: ENSG00000105989
Pharos: P09544(Tbio)
UniProt: P09544 A0A384MDX3
LinkDB
Position
7:complement(117275451..117323058)
AA seq 360 aa
MNAPLGGIWLWLPLLLTWLTPEVNSSWWYMRATGGSSRVMCDNVPGLVSSQRQLCHRHPD
VMRAISQGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVV
FAITRACSQGEVKSCSCDPKKMGSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSHVTRMTKCGCKFHWCCAVRCQDCLEALDVHTCKAPKNADWTTAT
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaacgcccctctcggtggaatctggctctggctccctctgctcttgacctggctcacc
cccgaggtcaactcttcatggtggtacatgagagctacaggtggctcctccagggtgatg
tgcgataatgtgccaggcctggtgagcagccagcggcagctgtgtcaccgacatccagat
gtgatgcgtgccattagccagggcgtggccgagtggacagcagaatgccagcaccagttc
cgccagcaccgctggaattgcaacaccctggacagggatcacagcctttttggcagggtc
ctactccgaagtagtcgggaatctgcctttgtttatgccatctcctcagctggagttgta
tttgccatcaccagggcctgtagccaaggagaagtaaaatcctgttcctgtgatccaaag
aagatgggaagcgccaaggacagcaaaggcatttttgattggggtggctgcagtgataac
attgactatgggatcaaatttgcccgcgcatttgtggatgcaaaggaaaggaaaggaaag
gatgccagagccctgatgaatcttcacaacaacagagctggcaggaaggctgtaaagcgg
ttcttgaaacaagagtgcaagtgccacggggtgagcggctcatgtactctcaggacatgc
tggctggccatggccgacttcaggaaaacgggcgattatctctggaggaagtacaatggg
gccatccaggtggtcatgaaccaggatggcacaggtttcactgtggctaacgagaggttt
aagaagccaacgaaaaatgacctcgtgtattttgagaattctccagactactgtatcagg
gaccgagaggcaggctccctgggtacagcaggccgtgtgtgcaacctgacttcccggggc
atggacagctgtgaagtcatgtgctgtgggagaggctacgacacctcccatgtcacccgg
atgaccaagtgtgggtgtaagttccactggtgctgcgccgtgcgctgtcaggactgcctg
gaagctctggatgtgcacacatgcaaggcccccaagaacgctgactggacaaccgctaca
tga

KEGG   Homo sapiens (human): 7482
Entry
7482              CDS       T01001                                 
Symbol
WNT2B, WNT13
Name
(RefSeq) Wnt family member 2B
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
nt06505  WNT signaling
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N01442  Wnt signaling modulation, Wnt inhibitor
N01443  Wnt signaling modulation, Wnt acylation
Disease
H01174  Congenital diarrhea
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7482 (WNT2B)
   04390 Hippo signaling pathway
    7482 (WNT2B)
   04150 mTOR signaling pathway
    7482 (WNT2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7482 (WNT2B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7482 (WNT2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7482 (WNT2B)
   05205 Proteoglycans in cancer
    7482 (WNT2B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7482 (WNT2B)
   05226 Gastric cancer
    7482 (WNT2B)
   05217 Basal cell carcinoma
    7482 (WNT2B)
   05224 Breast cancer
    7482 (WNT2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7482 (WNT2B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    7482 (WNT2B)
   05022 Pathways of neurodegeneration - multiple diseases
    7482 (WNT2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7482 (WNT2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7482 (WNT2B)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Morphogens
   7482 (WNT2B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 7482
NCBI-ProteinID: NP_078613
OMIM: 601968
HGNC: 12781
Ensembl: ENSG00000134245
Pharos: Q93097(Tbio)
UniProt: Q93097
LinkDB
Position
1:112466541..112530165
AA seq 391 aa
MLRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLLTLPARVDTSW
WYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTT
LDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQR
GDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCH
GVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLV
YFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFH
WCCAVRCKECRNTVDVHTCKAPKKAEWLDQT
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgctgagaccgggtggtgcggaggaagctgcgcagctcccgcttcggcgcgccagcgcc
ccggtccctgtgccgtcgcccgcggcccccgacggctcccgggcttcggcccgcctaggt
cttgcctgccttctgctcctgctgctgctgacgctgccggcccgcgtagacacgtcctgg
tggtacattggggcactgggggcacgagtgatctgtgacaatatccctggtttggtgagc
cggcagcggcagctgtgccagcgttacccagacatcatgcgttcagtgggcgagggtgcc
cgagaatggatccgagagtgtcagcaccaattccgccaccaccgctggaactgtaccacc
ctggaccgggaccacaccgtctttggccgtgtcatgctcagaagtagccgagaggcagct
tttgtatatgccatctcatcagcaggggtagtccacgctattactcgcgcctgtagccag
ggtgaactgagtgtgtgcagctgtgacccctacacccgtggccgacaccatgaccagcgt
ggggactttgactggggtggctgcagtgacaacatccactacggtgtccgttttgccaag
gccttcgtggatgccaaggagaagaggcttaaggatgcccgggccctcatgaacttacat
aataaccgctgtggtcgcacggctgtgcggcggtttctgaagctggagtgtaagtgccat
ggcgtgagtggttcctgtactctgcgcacctgctggcgtgcactctcagatttccgccgc
acaggtgattacctgcggcgacgctatgatggggctgtgcaggtgatggccacccaagat
ggtgccaacttcaccgcagcccgccaaggctatcgccgtgccacccggactgatcttgtc
tactttgacaactctccagattactgtgtcttggacaaggctgcaggttccctaggcact
gcaggccgtgtctgcagcaagacatcaaaaggaacagacggttgtgaaatcatgtgctgt
ggccgagggtacgacacaactcgagtcacccgtgttacccagtgtgagtgcaaattccac
tggtgctgtgctgtacggtgcaaggaatgcagaaatactgtggacgtccatacttgcaaa
gcccccaagaaggcagagtggctggaccaaacctga

KEGG   Homo sapiens (human): 7473
Entry
7473              CDS       T01001                                 
Symbol
WNT3, INT4, TETAMS
Name
(RefSeq) Wnt family member 3
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
nt06505  WNT signaling
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N01442  Wnt signaling modulation, Wnt inhibitor
N01443  Wnt signaling modulation, Wnt acylation
Disease
H00636  Tetra-amelia syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7473 (WNT3)
   04390 Hippo signaling pathway
    7473 (WNT3)
   04150 mTOR signaling pathway
    7473 (WNT3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7473 (WNT3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7473 (WNT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7473 (WNT3)
   05206 MicroRNAs in cancer
    7473 (WNT3)
   05205 Proteoglycans in cancer
    7473 (WNT3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7473 (WNT3)
   05226 Gastric cancer
    7473 (WNT3)
   05217 Basal cell carcinoma
    7473 (WNT3)
   05224 Breast cancer
    7473 (WNT3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7473 (WNT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    7473 (WNT3)
   05022 Pathways of neurodegeneration - multiple diseases
    7473 (WNT3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7473 (WNT3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7473 (WNT3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Morphogens
   7473 (WNT3)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 7473
NCBI-ProteinID: NP_110380
OMIM: 165330
HGNC: 12782
Ensembl: ENSG00000108379
Pharos: P56703(Tchem)
UniProt: P56703
Structure
LinkDB
Position
17:complement(46762506..46818692)
AA seq 355 aa
MEPHLLGLLLGLLLGGTRVLAGYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCR
NYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIAS
AGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRP
DARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDS
ASEMVVEKHRESRGWVETLRAKYSLFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC
NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECIRIYDVHTCK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggagccccacctgctcgggctgctcctcggcctcctgctcggtggcaccagggtcctc
gctggctacccaatttggtggtccctggccctgggccagcagtacacatctctgggctca
cagcccctgctctgcggctccatcccaggcctggtccccaagcaactgcgcttctgccgc
aattacatcgagatcatgcccagcgtggccgagggcgtgaagctgggcatccaggagtgc
cagcaccagttccggggccgccgctggaactgcaccaccatagatgacagcctggccatc
tttgggcccgtcctcgacaaagccacccgcgagtcggccttcgttcacgccatcgcctcg
gccggcgtggccttcgccgtcacccgctcctgcgccgagggcacctccaccatttgcggc
tgtgactcgcatcataaggggccgcctggcgaaggctggaagtggggcggctgcagcgag
gacgctgacttcggcgtgttagtgtccagggagttcgcggatgcgcgcgagaacaggccg
gacgcgcgctcggccatgaacaagcacaacaacgaggcgggccgcacgactatcctggac
cacatgcacctcaaatgcaagtgccacgggctgtcgggcagctgtgaggtgaagacctgc
tggtgggcgcagcctgacttccgtgccatcggtgacttcctcaaggacaagtatgacagc
gcctcggagatggtagtagagaagcaccgtgagtcccgaggctgggtggagaccctccgg
gccaagtactcgctcttcaagccacccacggagagggacctggtctactacgagaactcc
cccaacttttgtgagcccaacccagagacgggttcctttggcacaagggaccggacttgc
aatgtcacctcccacggcatcgatggctgcgatctgctctgctgtggccggggccacaac
acgaggacggagaagcggaaggaaaaatgccactgcatcttccactggtgctgctacgtc
agctgccaggagtgtattcgcatctacgacgtgcacacctgcaagtag

DBGET integrated database retrieval system