KEGG   Homo sapiens (human): 651
Entry
651               CDS       T01001                                 
Symbol
BMP3, BMP-3A
Name
(RefSeq) bone morphogenetic protein 3
  KO
K05496  bone morphogenetic protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    651 (BMP3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    651 (BMP3)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   651 (BMP3)
SSDB
Motif
Pfam: TGF_beta HD-ZIP_N
Other DBs
NCBI-GeneID: 651
NCBI-ProteinID: NP_001192
OMIM: 112263
HGNC: 1070
Ensembl: ENSG00000152785
Pharos: P12645(Tbio)
UniProt: P12645
Structure
LinkDB
Position
4:81030708..81057627
AA seq 472 aa
MAGASRLLFLWLGCFCVSLAQGERPKPPFPELRKAVPGDRTAGGGPDSELQPQDKVSEHM
LRLYDRYSTVQAARTPGSLEGGSQPWRPRLLREGNTVRSFRAAAAETLERKGLYIFNLTS
LTKSENILSATLYFCIGELGNISLSCPVSGGCSHHAQRKHIQIDLSAWTLKFSRNQSQLL
GHLSVDMAKSHRDIMSWLSKDITQLLRKAKENEEFLIGFNITSKGRQLPKRRLPFPEPYI
LVYANDAAISEPESVVSSLQGHRNFPTGTVPKWDSHIRAALSIERRKKRSTGVLLPLQNN
ELPGAEYQYKKDEVWEERKPYKTLQAQAPEKSKNKKKQRKGPHRKSQTLQFDEQTLKKAR
RKQWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQ
SIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR
NT seq 1419 nt   +upstreamnt  +downstreamnt
atggctggggcgagcaggctgctctttctgtggctgggctgcttctgcgtgagcctggcg
cagggagagagaccgaagccacctttcccggagctccgcaaagctgtgccaggtgaccgc
acggcaggtggtggcccggactccgagctgcagccgcaagacaaggtctctgaacacatg
ctgcggctctatgacaggtacagcacggtccaggcggcccggacaccgggctccctggag
ggaggctcgcagccctggcgccctcggctcctgcgcgaaggcaacacggttcgcagcttt
cgggcggcagcagcagaaactcttgaaagaaaaggactgtatatcttcaatctgacatcg
ctaaccaagtctgaaaacattttgtctgccacactgtatttctgtattggagagctagga
aacatcagcctgagttgtccagtgtctggaggatgctcccatcatgctcagaggaaacac
attcagattgatctttctgcatggaccctcaaattcagcagaaaccaaagtcaactcctt
ggccatctgtcagtggatatggccaaatctcatcgagatattatgtcctggctgtctaaa
gatatcactcaactcttgaggaaggccaaagaaaatgaagagttcctcataggatttaac
attacgtccaagggacgccagctgccaaagaggaggttaccttttccagagccttatatc
ttggtatatgccaatgatgccgccatttctgagccagaaagtgtggtatcaagcttacag
ggacaccggaattttcccactggaactgttcccaaatgggatagccacatcagagctgcc
ctttccattgagcggaggaagaagcgctctactggggtcttgctgcctctgcagaacaac
gagcttcctggggcagaataccagtataaaaaggatgaggtgtgggaggagagaaagcct
tacaagacccttcaggctcaggcccctgaaaagagtaagaataaaaagaaacagagaaag
gggcctcatcggaagagccagacgctccaatttgatgagcagaccctgaaaaaggcaagg
agaaagcagtggattgaacctcggaattgcgccaggagatacctcaaggtagactttgca
gatattggctggagtgaatggattatctcccccaagtcctttgatgcctattattgctct
ggagcatgccagttccccatgccaaagtctttgaagccatcaaatcatgctaccatccag
agtatagtgagagctgtgggggtcgttcctgggattcctgagccttgctgtgtaccagaa
aagatgtcctcactcagtattttattctttgatgaaaataagaatgtagtgcttaaagta
taccctaacatgacagtagagtcttgcgcttgcagataa

DBGET integrated database retrieval system