KEGG   Homo sapiens (human): 6602
Entry
6602              CDS       T01001                                 
Symbol
SMARCD1, BAF60A, CRACD1, CSS11, Rsc6p
Name
(RefSeq) SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1
  KO
K11650  SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D
Organism
hsa  Homo sapiens (human)
Pathway
hsa04714  Thermogenesis
hsa05225  Hepatocellular carcinoma
Disease
H01403  Coffin-Siris syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    6602 (SMARCD1)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    6602 (SMARCD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    6602 (SMARCD1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    6602 (SMARCD1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     6602 (SMARCD1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    6602 (SMARCD1)
   PBAF complex
    6602 (SMARCD1)
   GBAF(ncBAF) complex
    6602 (SMARCD1)
SSDB
Motif
Pfam: SWIB SusD_RagB DivIC
Other DBs
NCBI-GeneID: 6602
NCBI-ProteinID: NP_003067
OMIM: 601735
HGNC: 11106
Ensembl: ENSG00000066117
Pharos: Q96GM5(Tbio)
UniProt: Q96GM5
Structure
LinkDB
Position
12:50085342..50100707
AA seq 515 aa
MAARAGFQSVAPSGGAGASGGAGAAAALGPGGTPGPPVRMGPAPGQGLYRSPMPGAAYPR
PGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRN
HNAKKKKMADKILPQRIRELVPESQAYMDLLAFERKLDQTIMRKRLDIQEALKRPIKQKR
KLRIFISNTFNPAKSDAEDGEGTVASWELRVEGRLLEDSALSKYDATKQKRKFSSFFKSL
VIELDKDLYGPDNHLVEWHRTATTQETDGFQVKRPGDVNVRCTVLLMLDYQPPQFKLDPR
LARLLGIHTQTRPVIIQALWQYIKTHKLQDPHEREFVICDKYLQQIFESQRMKFSEIPQR
LHALLMPPEPIIINHVISVDPNDQKKTACYDIDVEVDDTLKTQMNSFLLSTASQQEIATL
DNKIHETIETINQLKTQREFMLSFARDPQGFINDWLQSQCRDLKTMTDVVGNPEEERRAE
FYFQPWAQEAVCRYFYSKVQQRRQELEQALGIRNT
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggcggcccgggcgggtttccagtctgtggctccaagcggcggcgccggagcctcagga
ggggcgggcgcggctgctgccttgggcccgggcggaactccggggcctcctgtgcgaatg
ggcccggctccgggtcaagggctgtaccgctccccgatgcccggagcggcctatccgaga
ccaggtatgttgccaggcagccgaatgacacctcagggaccttccatgggaccccctggc
tatggggggaacccttcagtccgacctggcctggcccagtcagggatggatcagtcccgc
aagagacctgcccctcagcagatccagcaggtccagcagcaggcggtccaaaatcgaaac
cacaatgcaaagaaaaagaagatggctgacaaaattctacctcaaaggattcgtgaactg
gtaccagaatcccaggcctatatggatctcttggcttttgaaaggaaactggaccagact
atcatgaggaaacggctagatatccaagaggccttgaaacgtcccatcaagcaaaaacgg
aagctgcgaattttcatttctaacactttcaatccggctaagtcagatgccgaggatggg
gaagggacggtggcttcctgggagcttcgggtagaaggacggctcctggaggattcagcc
ttgtccaaatatgatgccactaaacaaaagaggaagttctcttccttttttaagtccttg
gtgattgaactggacaaagacctgtatgggccagacaaccatctggtagaatggcacagg
accgccactacccaggagaccgatggctttcaggtgaagcggccgggagacgtgaatgta
cggtgtactgtcctactgatgctggattaccagcctccccagtttaaattagacccccgc
ctagctcgactcctgggcatccatacccagactcgtccagtgatcatccaagcactgtgg
caatatattaagacacataagctccaggaccctcacgagcgggagtttgtcatctgtgac
aagtacctgcagcagatctttgagtctcaacgtatgaagttttcagagatccctcagcgg
ctccatgccttgcttatgccaccagaacctatcatcattaatcatgtcatcagtgttgac
ccgaatgatcagaaaaagacagcttgttatgacattgatgttgaagtggatgacaccttg
aagacccagatgaattcttttctgctgtccactgccagccaacaggagattgctactcta
gacaacaagatccatgagacaatagaaaccatcaaccagctgaagactcagcgggagttc
atgctgagctttgccagagaccctcagggtttcatcaatgactggcttcagtcccagtgc
agggacctcaagacaatgactgatgtggtgggtaacccagaggaggagcgccgagctgag
ttctacttccagccctgggctcaggaggctgtgtgccgatacttctactccaaggtgcag
cagagacgacaagaattagagcaagccctgggaatccggaatacatag

KEGG   Homo sapiens (human): 6603
Entry
6603              CDS       T01001                                 
Symbol
SMARCD2, BAF60B, CRACD2, PRO2451, Rsc6p, SGD2
Name
(RefSeq) SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
  KO
K11650  SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D
Organism
hsa  Homo sapiens (human)
Pathway
hsa04714  Thermogenesis
hsa05225  Hepatocellular carcinoma
Disease
H02024  Neutrophil specific granule deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    6603 (SMARCD2)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    6603 (SMARCD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    6603 (SMARCD2)
   03036 Chromosome and associated proteins [BR:hsa03036]
    6603 (SMARCD2)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     6603 (SMARCD2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    6603 (SMARCD2)
   PBAF complex
    6603 (SMARCD2)
   GBAF(ncBAF) complex
    6603 (SMARCD2)
SSDB
Motif
Pfam: SWIB
Other DBs
NCBI-GeneID: 6603
NCBI-ProteinID: NP_001091896
OMIM: 601736
HGNC: 11107
Ensembl: ENSG00000108604
Pharos: Q92925(Tbio)
UniProt: Q92925
LinkDB
Position
17:complement(63832081..63842685)
AA seq 531 aa
MSGRGAGGFPLPPLSPGGGAVAAALGAPPPPAGPGMLPGPALRGPGPAGGVGGPGAAAFR
PMGPAGPAAQYQRPGMSPGNRMPMAGLQVGPPAGSPFGAAAPLRPGMPPTMMDPFRKRLL
VPQAQPPMPAQRRGLKRRKMADKVLPQRIRELVPESQAYMDLLAFERKLDQTIARKRMEI
QEAIKKPLTQKRKLRIYISNTFSPSKAEGDSAGTAGTPGGTPAGDKVASWELRVEGKLLD
DPSKQKRKFSSFFKSLVIELDKELYGPDNHLVEWHRMPTTQETDGFQVKRPGDLNVKCTL
LLMLDHQPPQYKLDPRLARLLGVHTQTRAAIMQALWLYIKHNQLQDGHEREYINCNRYFR
QIFSCGRLRFSEIPMKLAGLLQHPDPIVINHVISVDPNDQKKTACYDIDVEVDDPLKAQM
SNFLASTTNQQEIASLDVKIHETIESINQLKTQRDFMLSFSTDPQDFIQEWLRSQRRDLK
IITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRLT
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgtcgggccgaggcgcgggcgggttcccgctgcccccgctaagccctggcggcggcgcc
gtggctgcggccctgggagcgccgcctccccccgcgggacccggcatgctgcccggaccg
gcgctccggggaccgggtccggcaggaggcgtggggggccccggggccgccgccttccgc
cccatgggccccgcgggccccgcggcgcagtaccagcgacctggcatgtcaccagggaac
cggatgcccatggctggcttgcaggtgggaccccctgctggctccccatttggtgcagca
gctccgcttcgacctggcatgccacccaccatgatggatccattccgaaaacgcctgctt
gtgccccaggcgcagcctcccatgcctgcccagcgccgggggttaaagaggaggaagatg
gcagataaggttctacctcagcgaatccgggagcttgttccagagtctcaggcgtacatg
gatctcttggcttttgagcggaagctggaccagaccattgctcgcaagcggatggagatc
caggaggccatcaaaaagcctctgacacaaaagcgaaagcttcggatctacatttccaat
acgttcagtcccagcaaggcggaaggcgatagtgcaggaactgcagggacccctggggga
accccagcaggggacaaggtggcttcctgggaactccgagtggaaggaaaactgctggat
gatcctagcaaacagaagaggaagttttcttcattctttaagagcctcgtcattgagctg
gacaaggagctgtacgggcctgacaatcacctggtggagtggcaccggatgcccaccacc
caggagacagatggcttccaagtaaaacggcctggagacctcaacgtcaagtgcaccctc
ctgctcatgctggatcatcagcctccccagtacaaattggacccccgattggcaaggctg
ctgggagtgcacacgcagacgagggccgccatcatgcaggccctgtggctttacatcaag
cacaaccagctgcaggatgggcacgagcgggagtacatcaactgcaaccgttacttccgc
cagatcttcagttgtggccgactccgtttctccgagattcccatgaagctggcagggttg
ctgcagcatccagaccccattgtcatcaaccatgtcattagtgtcgaccctaacgaccag
aagaagacagcctgttacgacatcgatgtggaggtggacgacccactgaaggcccaaatg
agcaattttctggcctctaccaccaatcagcaggagatcgcctcccttgatgtcaagatc
catgagaccattgagtccatcaaccagctgaagacccagagagatttcatgctcagtttt
agcaccgacccccaggacttcatccaggaatggctccgttcccagcgccgagacctcaag
atcatcactgatgtgattggaaatcctgaggaggagagacgagctgctttctaccaccag
ccctgggcccaggaagcagtaggcaggcacatctttgccaaggtgcagcagcgaaggcag
gaactggaacaggtgctgggaattcgcctgacctaa

KEGG   Homo sapiens (human): 6604
Entry
6604              CDS       T01001                                 
Symbol
SMARCD3, BAF60C, CRACD3, Rsc6p
Name
(RefSeq) SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
  KO
K11650  SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D
Organism
hsa  Homo sapiens (human)
Pathway
hsa04714  Thermogenesis
hsa05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    6604 (SMARCD3)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    6604 (SMARCD3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    6604 (SMARCD3)
   03036 Chromosome and associated proteins [BR:hsa03036]
    6604 (SMARCD3)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     6604 (SMARCD3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    6604 (SMARCD3)
   PBAF complex
    6604 (SMARCD3)
   GBAF(ncBAF) complex
    6604 (SMARCD3)
SSDB
Motif
Pfam: SWIB DUF5529
Other DBs
NCBI-GeneID: 6604
NCBI-ProteinID: NP_001003801
OMIM: 601737
HGNC: 11108
Ensembl: ENSG00000082014
Pharos: Q6STE5(Tbio)
UniProt: Q6STE5
LinkDB
Position
7:complement(151238780..151277149)
AA seq 483 aa
MAADEVAGGARKATKSKLFEFLVHGVRPGMPSGARMPHQGAPMGPPGSPYMGSPAVRPGL
APAGMEPARKRAAPPPGQSQAQSQGQPVPTAPARSRSAKRRKMADKILPQRIRELVPESQ
AYMDLLAFERKLDQTIMRKRVDIQEALKRPMKQKRKLRLYISNTFNPAKPDAEDSDGSIA
SWELRVEGKLLDDPSKQKRKFSSFFKSLVIELDKDLYGPDNHLVEWHRTPTTQETDGFQV
KRPGDLSVRCTLLLMLDYQPPQFKLDPRLARLLGLHTQSRSAIVQALWQYVKTNRLQDSH
DKEYINGDKYFQQIFDCPRLKFSEIPQRLTALLLPPDPIVINHVISVDPSDQKKTACYDI
DVEVEEPLKGQMSSFLLSTANQQEISALDSKIHETIESINQLKIQRDFMLSFSRDPKGYV
QDLLRSQSRDLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLVV
RNT
NT seq 1452 nt   +upstreamnt  +downstreamnt
atggccgcggacgaagttgccggaggggcgcgcaaagccacgaaaagcaaactttttgag
tttctggtccatggggtgcgccccgggatgccgtctggagcccggatgccccaccagggg
gcgcccatgggccccccgggctccccgtacatgggcagccccgccgtgcgacccggcctg
gcccccgcgggcatggagcccgcccgcaagcgagcagcgcccccgcccgggcagagccag
gcacagagccagggccagccggtgcccaccgcccccgcgcggagccgcagtgccaagagg
aggaagatggctgacaaaatcctccctcaaaggattcgggagctggtccccgagtcccag
gcttacatggacctcttggcatttgagaggaaactggatcaaaccatcatgcggaagcgg
gtggacatccaggaggctctgaagaggcccatgaagcaaaagcggaagctgcgactctat
atctccaacacttttaaccctgcgaagcctgatgctgaggattccgacggcagcattgcc
tcctgggagctacgggtggaggggaagctcctggatgatcccagcaaacagaagcggaag
ttctcttctttcttcaagagtttggtcatcgagctggacaaagatctttatggccctgac
aaccacctcgttgagtggcatcggacacccacgacccaggagacggacggcttccaggtg
aaacggcctggggacctgagtgtgcgctgcacgctgctcctcatgctggactaccagcct
ccccagttcaaactggatccccgcctagcccggctgctggggctgcacacacagagccgc
tcagccattgtccaggccctgtggcagtatgtgaagaccaacaggctgcaggactcccat
gacaaggaatacatcaatggggacaagtatttccagcagatttttgattgtccccggctg
aagttttctgagattccccagcgcctcacagccctgctattgccccctgacccaattgtc
atcaaccatgtcatcagcgtggacccttcagaccagaagaagacggcgtgctatgacatt
gacgtggaggtggaggagccattaaaggggcagatgagcagcttcctcctatccacggcc
aaccagcaggagatcagtgctctggacagtaagatccatgagacgattgagtccataaac
cagctcaagatccagagggacttcatgctaagcttctccagagaccccaaaggctatgtc
caagacctgctccgctcccagagccgggacctcaaggtgatgacagatgtagccggcaac
cctgaagaggagcgccgggctgagttctaccaccagccctggtcccaggaggccgtcagt
cgctacttctactgcaagatccagcagcgcaggcaggagctggagcagtcgctggttgtg
cgcaacacctag

DBGET integrated database retrieval system