KEGG   Homo sapiens (human): 6628
Entry
6628              CDS       T01001                                 
Symbol
SNRPB, CCMS, COD, SNRPB1, Sm-B/B', SmB/B', SmB/SmB', snRNP-B
Name
(RefSeq) small nuclear ribonucleoprotein polypeptides B and B1
  KO
K11086  small nuclear ribonucleoprotein B and B'
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05322  Systemic lupus erythematosus
Disease
H01843  Cerebrocostomandibular syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6628 (SNRPB)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    6628 (SNRPB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    6628 (SNRPB)
   03041 Spliceosome [BR:hsa03041]
    6628 (SNRPB)
   03032 DNA replication proteins [BR:hsa03032]
    6628 (SNRPB)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    U7-dependent histone pre-mRNA processing factors
     6628 (SNRPB)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    6628 (SNRPB)
  U2 snRNP components
    6628 (SNRPB)
 Complex B
  U1 snRNP components
    6628 (SNRPB)
  U4/U6.U5 tri-snRNP components
    6628 (SNRPB)
 Complex C
  U2 snRNP components
    6628 (SNRPB)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     6628 (SNRPB)
SSDB
Motif
Pfam: LSM
Other DBs
NCBI-GeneID: 6628
NCBI-ProteinID: NP_937859
OMIM: 182282
HGNC: 11153
Ensembl: ENSG00000125835
Pharos: P14678(Tbio)
UniProt: P14678
Structure
LinkDB
Position
20:complement(2461642..2470789)
AA seq 240 aa
MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAE
REEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPM
PQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMG
RGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP
NT seq 723 nt   +upstreamnt  +downstreamnt
atgacggtgggcaagagcagcaagatgctgcagcatattgattacaggatgaggtgcatc
ctgcaggacggccggatcttcattggcaccttcaaggcttttgacaagcacatgaatttg
atcctctgtgactgtgatgagttcagaaagatcaagccaaagaactccaaacaagcagaa
agggaagagaagcgagtcctcggtctggtgctgctgcgaggggagaatctggtctcaatg
acagtagagggacctcctcccaaagatactggtattgctcgagttccacttgctggagct
gccgggggcccagggatcggcagggctgctggcagaggaatcccagctggggttcccatg
ccccaggctcctgcaggacttgctgggccagtccgtggggttggcgggccatcccaacag
gtgatgaccccacaaggaagaggtactgttgcagccgctgcagctgctgccacagccagt
attgccggggctccaacccagtacccacctggccgtgggggtcctcccccacctatgggc
cgaggagcaccccctccaggcatgatgggcccacctcctggtatgagacctcctatgggt
cccccaatggggatcccccctggaagagggactccaatgggcatgccccctccgggaatg
cggcctcctccccctgggatgcgagggccccctcccccgggaatgcgcccaccaaggccc
tag

KEGG   Homo sapiens (human): 6632
Entry
6632              CDS       T01001                                 
Symbol
SNRPD1, HsT2456, SMD1, SNRPD, Sm-D1
Name
(RefSeq) small nuclear ribonucleoprotein D1 polypeptide
  KO
K11087  small nuclear ribonucleoprotein D1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6632 (SNRPD1)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    6632 (SNRPD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6632 (SNRPD1)
   03032 DNA replication proteins [BR:hsa03032]
    6632 (SNRPD1)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    6632 (SNRPD1)
  U2 snRNP components
    6632 (SNRPD1)
 Complex B
  U1 snRNP components
    6632 (SNRPD1)
  U4/U6.U5 tri-snRNP components
    6632 (SNRPD1)
 Complex C
  U2 snRNP components
    6632 (SNRPD1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     6632 (SNRPD1)
SSDB
Motif
Pfam: LSM Gemin7 Hfq SM-ATX API5
Other DBs
NCBI-GeneID: 6632
NCBI-ProteinID: NP_008869
OMIM: 601063
HGNC: 11158
Ensembl: ENSG00000167088
Pharos: P62314(Tbio)
UniProt: P62314
Structure
LinkDB
Position
18:21612314..21633520
AA seq 119 aa
MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSI
RGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR
NT seq 360 nt   +upstreamnt  +downstreamnt
atgaagctcgtgagatttttgatgaaattgagtcatgaaactgtaaccattgaattgaag
aacggaacacaggtccatggaacaatcacaggtgtggatgtcagcatgaatacacatctt
aaagctgtgaaaatgaccctgaagaacagagaacctgtacagctggaaacgctgagtatt
cgaggaaataacattcggtattttattctaccagacagtttacctctggatacactactt
gtggatgttgaacctaaggtgaaatctaagaaaagggaagctgttgcaggaagaggcaga
ggaagaggaagaggaagaggacgtggccgtggcagaggaagagggggtcctaggcgataa

KEGG   Homo sapiens (human): 6633
Entry
6633              CDS       T01001                                 
Symbol
SNRPD2, SMD2, SNRPD1, Sm-D2
Name
(RefSeq) small nuclear ribonucleoprotein D2 polypeptide
  KO
K11096  small nuclear ribonucleoprotein D2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6633 (SNRPD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    6633 (SNRPD2)
   03032 DNA replication proteins [BR:hsa03032]
    6633 (SNRPD2)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    6633 (SNRPD2)
  U2 snRNP components
    6633 (SNRPD2)
 Complex B
  U1 snRNP components
    6633 (SNRPD2)
  U4/U6.U5 tri-snRNP components
    6633 (SNRPD2)
 Complex C
  U2 snRNP components
    6633 (SNRPD2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     6633 (SNRPD2)
SSDB
Motif
Pfam: LSM Hfq
Other DBs
NCBI-GeneID: 6633
NCBI-ProteinID: NP_004588
OMIM: 601061
HGNC: 11159
Ensembl: ENSG00000125743
Pharos: P62316(Tbio)
UniProt: P62316
Structure
LinkDB
Position
19:complement(45687454..45692316)
AA seq 118 aa
MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFD
RHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK
NT seq 357 nt   +upstreamnt  +downstreamnt
atgagcctcctcaacaagcccaagagtgagatgaccccagaggagctgcagaagcgagag
gaggaggaatttaacaccggtccactctctgtgctcacacagtcagtcaagaacaatacc
caagtgctcatcaactgccgcaacaataagaaactcctgggccgcgtgaaggccttcgat
aggcactgcaacatggtgctggagaacgtgaaggagatgtggactgaggtacccaagagt
ggcaagggcaagaagaagtccaagccagtcaacaaagaccgctacatctccaagatgttc
ctgcgcggggactcagtcatcgtggtcctgcggaacccgctcatcgccggcaagtag

KEGG   Homo sapiens (human): 6634
Entry
6634              CDS       T01001                                 
Symbol
SNRPD3, SMD3, Sm-D3
Name
(RefSeq) small nuclear ribonucleoprotein D3 polypeptide
  KO
K11088  small nuclear ribonucleoprotein D3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6634 (SNRPD3)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    6634 (SNRPD3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    6634 (SNRPD3)
   03041 Spliceosome [BR:hsa03041]
    6634 (SNRPD3)
   03032 DNA replication proteins [BR:hsa03032]
    6634 (SNRPD3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    U7-dependent histone pre-mRNA processing factors
     6634 (SNRPD3)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    6634 (SNRPD3)
  U2 snRNP components
    6634 (SNRPD3)
 Complex B
  U1 snRNP components
    6634 (SNRPD3)
  U4/U6.U5 tri-snRNP components
    6634 (SNRPD3)
 Complex C
  U2 snRNP components
    6634 (SNRPD3)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     6634 (SNRPD3)
SSDB
Motif
Pfam: LSM Kringle
Other DBs
NCBI-GeneID: 6634
NCBI-ProteinID: NP_001265585
OMIM: 601062
HGNC: 11160
Ensembl: ENSG00000100028
Pharos: P62318(Tbio)
UniProt: P62318
Structure
LinkDB
Position
22:24555650..24574971
AA seq 126 aa
MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQ
VYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGN
IFQKRR
NT seq 381 nt   +upstreamnt  +downstreamnt
atgtctattggtgtgccgattaaagtactgcatgaggccgagggccacattgtgacatgt
gagacgaacaccggtgaggtatatcgggggaagctcattgaagcagaggacaacatgaac
tgccagatgtccaacatcacagtcacatacagagatggccgagtggcacagctggagcag
gtatacatccgtggcagcaaaatccgctttctgattttgcctgacatgctgaagaacgca
cccatgttaaagagcatgaaaaataaaaaccaaggctcaggggctggccgaggaaaagct
gctattctcaaggcccaagtggccgcaagaggaagaggacgtggaatgggacgtggaaac
atctttcaaaagcgaagataa

KEGG   Homo sapiens (human): 6635
Entry
6635              CDS       T01001                                 
Symbol
SNRPE, HYPT11, SME, Sm-E, snRNP-E
Name
(RefSeq) small nuclear ribonucleoprotein polypeptide E
  KO
K11097  small nuclear ribonucleoprotein E
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Disease
H00786  Hypotrichosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6635 (SNRPE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    6635 (SNRPE)
   03041 Spliceosome [BR:hsa03041]
    6635 (SNRPE)
   03032 DNA replication proteins [BR:hsa03032]
    6635 (SNRPE)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    U7-dependent histone pre-mRNA processing factors
     6635 (SNRPE)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    6635 (SNRPE)
  U2 snRNP components
    6635 (SNRPE)
 Complex B
  U1 snRNP components
    6635 (SNRPE)
  U4/U6.U5 tri-snRNP components
    6635 (SNRPE)
 Complex C
  U2 snRNP components
    6635 (SNRPE)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     6635 (SNRPE)
SSDB
Motif
Pfam: LSM Hfq
Other DBs
NCBI-GeneID: 6635
NCBI-ProteinID: NP_003085
OMIM: 128260
HGNC: 11161
Ensembl: ENSG00000182004
Pharos: P62304(Tbio)
UniProt: P62304
Structure
LinkDB
Position
1:203861599..203871152
AA seq 92 aa
MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDD
AEEIHSKTKSRKQLGRIMLKGDNITLLQSVSN
NT seq 279 nt   +upstreamnt  +downstreamnt
atggcgtaccgtggccagggtcagaaagtgcagaaggttatggtgcagcccatcaacctc
atcttcagatacttacaaaatagatcgcggattcaggtgtggctctatgagcaagtgaat
atgcggatagaaggctgtatcattggttttgatgagtatatgaaccttgtattagatgat
gcagaagagattcattctaaaacaaagtcaagaaaacaactgggtcggatcatgctaaaa
ggagataatattactctgctacaaagtgtctccaactag

KEGG   Homo sapiens (human): 6636
Entry
6636              CDS       T01001                                 
Symbol
SNRPF, SMF, Sm-F, snRNP-F
Name
(RefSeq) small nuclear ribonucleoprotein polypeptide F
  KO
K11098  small nuclear ribonucleoprotein F
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6636 (SNRPF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    6636 (SNRPF)
   03041 Spliceosome [BR:hsa03041]
    6636 (SNRPF)
   03032 DNA replication proteins [BR:hsa03032]
    6636 (SNRPF)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    U7-dependent histone pre-mRNA processing factors
     6636 (SNRPF)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    6636 (SNRPF)
  U2 snRNP components
    6636 (SNRPF)
 Complex B
  U1 snRNP components
    6636 (SNRPF)
  U4/U6.U5 tri-snRNP components
    6636 (SNRPF)
 Complex C
  U2 snRNP components
    6636 (SNRPF)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     6636 (SNRPF)
SSDB
Motif
Pfam: LSM SM-ATX
Other DBs
NCBI-GeneID: 6636
NCBI-ProteinID: NP_003086
OMIM: 603541
HGNC: 11162
Ensembl: ENSG00000139343
Pharos: P62306(Tdark)
UniProt: P62306
Structure
LinkDB
Position
12:95858952..95866140
AA seq 86 aa
MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLG
EVLIRCNNVLYIRGVEEEEEDGEMRE
NT seq 261 nt   +upstreamnt  +downstreamnt
atgagtttacccctcaatcccaaacctttcctcaatggactaacaggaaagccagtgatg
gtgaaacttaagtggggaatggagtacaagggctatctggtatctgtagatggctacatg
aacatgcagcttgcaaatacagaagaatacatagatggagctttgtctggacatctgggt
gaagttttaataaggtgtaataatgtcctttatatcagaggtgtggaagaagaggaagaa
gatggggaaatgagagaatag

KEGG   Homo sapiens (human): 6637
Entry
6637              CDS       T01001                                 
Symbol
SNRPG, SMG, Sm-G
Name
(RefSeq) small nuclear ribonucleoprotein polypeptide G
  KO
K11099  small nuclear ribonucleoprotein G
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    6637 (SNRPG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    6637 (SNRPG)
   03041 Spliceosome [BR:hsa03041]
    6637 (SNRPG)
   03032 DNA replication proteins [BR:hsa03032]
    6637 (SNRPG)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    U7-dependent histone pre-mRNA processing factors
     6637 (SNRPG)
Spliceosome [BR:hsa03041]
 Complex A
  U1 snRNP components
   Sm proteins
    6637 (SNRPG)
  U2 snRNP components
    6637 (SNRPG)
 Complex B
  U1 snRNP components
    6637 (SNRPG)
  U4/U6.U5 tri-snRNP components
    6637 (SNRPG)
 Complex C
  U2 snRNP components
    6637 (SNRPG)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Telomerase complex (fungi)
    Sm core complex
     6637 (SNRPG)
SSDB
Motif
Pfam: LSM
Other DBs
NCBI-GeneID: 6637
NCBI-ProteinID: NP_003087
OMIM: 603542
HGNC: 11163
Ensembl: ENSG00000143977
Pharos: P62308(Tdark)
UniProt: P62308
Structure
LinkDB
Position
2:complement(70281362..70293740)
AA seq 76 aa
MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMV
VIRGNSIIMLEALERV
NT seq 231 nt   +upstreamnt  +downstreamnt
atgagcaaagctcaccctcccgagttgaaaaaatttatggacaagaagttatcattgaaa
ttaaatggtggcagacatgtccaaggaatattgcggggatttgatccctttatgaacctt
gtgatagatgaatgtgtggagatggcgactagtggacaacagaacaatattggaatggtg
gtaatacgaggaaatagtatcatcatgttagaagccttggaacgagtataa

DBGET integrated database retrieval system