KEGG   Homo sapiens (human): 6642
Entry
6642              CDS       T01001                                 
Symbol
SNX1, HsT17379, VPS5
Name
(RefSeq) sorting nexin 1
  KO
K17917  sorting nexin-1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    6642 (SNX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    6642 (SNX1)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    6642 (SNX1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Macropinocytosis
   Sorting nexins
    6642 (SNX1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Phox homology (PX) domain-containing proteins
  Sorting nexins
   6642 (SNX1)
SSDB
Motif
Pfam: Vps5 Sorting_nexin PX BAR_3_WASP_bdg
Other DBs
NCBI-GeneID: 6642
NCBI-ProteinID: NP_003090
OMIM: 601272
HGNC: 11172
Ensembl: ENSG00000028528
Pharos: Q13596(Tbio)
UniProt: Q13596
Structure
LinkDB
Position
15:64095982..64144231
AA seq 522 aa
MASGGGGCSASERLPPPFPGLEPESEGAAGGSEPEAGDSDTEGEDIFTGAAVVSKHQSPK
ITTSLLPINNGSKENGIHEEQDQEPQDLFADATVELSLDSTQNNQKKVLAKTLISLPPQE
ATNSSKPQPTYEELEEEEQEDQFDLTVGITDPEKIGDGMNAYVAYKVTTQTSLPLFRSKQ
FAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRA
ALERYLQRIVNHPTMLQDPDVREFLEKEELPRAVGTQTLSGAGLLKMFNKATDAVSKMTI
KMNESDIWFEEKLQEVECEEQRLRKLHAVVETLVNHRKELALNTAQFAKSLAMLGSSEDN
TALSRALSQLAEVEEKIEQLHQEQANNDFFLLAELLSDYIRLLAIVRAAFDQRMKTWQRW
QDAQATLQKKREAEARLLWANKPDKLQQAKDEILEWESRVTQYERDFERISTVVRKEVIR
FEKEKSKDFKNHVIKYLETLLYSQQQLAKYWEAFLPEAKAIS
NT seq 1569 nt   +upstreamnt  +downstreamnt
atggcgtcgggtggtggtggctgtagcgcttcggagagactgcctccgcccttccccggc
ctggagccggagtccgagggggcggccgggggatcagaacccgaggctggggacagcgac
accgagggggaggacattttcaccggcgccgcggtggtcagtaaacatcagtctccaaag
ataactacatcccttcttcccatcaacaatggctccaaagaaaatgggatccatgaagaa
caagaccaagagccacaggatctctttgcagatgccacagtggagctatccttggacagc
acacaaaataatcagaagaaggtgctagccaaaacactcatttctcttcctcctcaggaa
gccacaaattcttcgaagccccagccaacctatgaggagctagaggaagaagaacaggag
gatcaatttgatttgacagtcggtataactgatcctgagaagataggggatggtatgaat
gcatatgtagcctacaaagttacaacacagacaagcttaccattgttcagaagcaaacag
tttgcagtaaaaagaagatttagtgactttctgggtctttatgagaagctttccgagaag
cactctcagaatggcttcattgtccctccgcccccggagaagagcctcatagggatgaca
aaagtgaaagttgggaaggaagattcttcttctgcagaatttcttgaaaaacggagggcc
gctttagaaaggtaccttcagaggattgtaaatcatcctaccatgttacaggaccctgac
gtcagagagttcttggaaaaagaagagctgccacgtgccgtgggtacccagacattgagt
ggtgctggtctcctcaagatgttcaacaaagccacagatgccgtcagcaaaatgaccatc
aagatgaatgaatcagacatttggtttgaggagaagctccaggaggtagagtgtgaggag
cagcgcttacggaaactgcatgctgttgtagaaactctagtcaaccataggaaagagcta
gcgctgaacacagcccagtttgcaaagagtctagccatgcttgggagctctgaggacaac
acggcattgtcacgggcactctcccagctggctgaggtggaagaaaaaattgagcagctc
caccaggaacaggccaacaatgacttcttcctccttgctgagctcctgagtgactacatt
cgcctcctggccatagtccgcgctgccttcgaccagcgcatgaagacatggcagcgctgg
caggatgcccaagccacactgcagaagaagcgggaggccgaggctcggctgctgtgggcc
aacaagcctgataagctgcagcaggccaaggacgagatcctcgagtgggagtctcgggtg
actcaatatgaaagggacttcgagaggatttcaacagtggtccgaaaagaagtgatacgg
tttgagaaagagaaatccaaggacttcaagaaccacgtgatcaagtaccttgagacactc
ctttactcacagcagcagctggcaaagtactgggaagccttccttcctgaggcaaaggcc
atctcctaa

KEGG   Homo sapiens (human): 6643
Entry
6643              CDS       T01001                                 
Symbol
SNX2, TRG-9
Name
(RefSeq) sorting nexin 2
  KO
K17917  sorting nexin-1/2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    6643 (SNX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    6643 (SNX2)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    6643 (SNX2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Macropinocytosis
   Sorting nexins
    6643 (SNX2)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Phox homology (PX) domain-containing proteins
  Sorting nexins
   6643 (SNX2)
SSDB
Motif
Pfam: Vps5 Sorting_nexin PX BAR_3_WASP_bdg FAM92 GrpE DUF3557 DUF3775 4HB_MCP_1
Other DBs
NCBI-GeneID: 6643
NCBI-ProteinID: NP_003091
OMIM: 605929
HGNC: 11173
Ensembl: ENSG00000205302
Pharos: O60749(Tbio)
UniProt: O60749
LinkDB
Position
5:122774996..122834543
AA seq 519 aa
MAAEREPPPLGDGKPTDFEDLEDGEDLFTSTVSTLESSPSSPEPASLPAEDISANSNGPK
PTEVVLDDDREDLFAEATEEVSLDSPEREPILSSEPSPAVTPVTPTTLIAPRIESKSMSA
PVIFDRSREEIEEEANGDIFDIEIGVSDPEKVGDGMNAYMAYRVTTKTSLSMFSKSEFSV
KRRFSDFLGLHSKLASKYLHVGYIVPPAPEKSIVGMTKVKVGKEDSSSTEFVEKRRAALE
RYLQRTVKHPTLLQDPDLRQFLESSELPRAVNTQALSGAGILRMVNKAADAVNKMTIKMN
ESDAWFEEKQQQFENLDQQLRKLHVSVEALVCHRKELSANTAAFAKSAAMLGNSEDHTAL
SRALSQLAEVEEKIDQLHQEQAFADFYMFSELLSDYIRLIAAVKGVFDHRMKCWQKWEDA
QITLLKKREAEAKMMVANKPDKIQQAKNEIREWEAKVQQGERDFEQISKTIRKEVGRFEK
ERVKDFKTVIIKYLESLVQTQQQLIKYWEAFLPEAKAIA
NT seq 1560 nt   +upstreamnt  +downstreamnt
atggcggccgagagggaacctcctccgctgggggacgggaagcccaccgactttgaggat
ctggaggacggagaggacctgttcaccagcactgtctccaccctagagtcaagtccatca
tctccagaaccagctagtcttcctgcagaagatattagtgcaaactccaatggcccaaaa
cccacagaagttgtattagatgatgacagagaagatctttttgcagaagccacagaagaa
gtttctttggacagccctgaaagggaacctatcctatcctcggaaccttctcctgcagtc
acacctgtcactcctactacactcattgctcctagaattgaatcaaagagtatgtctgct
cccgtgatctttgatagatccagggaagagattgaagaagaagcaaatggagacattttt
gacatagaaattggtgtatcagatccagaaaaagttggtgatggcatgaatgcctatatg
gcatatagagtaacaacaaagacatctctttccatgttcagtaagagtgaattttcagtg
aaaagaagattcagcgactttcttggtttgcacagcaaattagcaagcaaatatttacat
gttggttatattgtgccaccagctccagaaaagagtatagtagggatgaccaaggtcaaa
gtgggtaaagaagactcatcatccactgagtttgtagaaaaacggagagcagctcttgaa
aggtatcttcaaagaacagtaaaacatccaactttactacaggatcctgatttaaggcag
ttcttggaaagttcagagctgcctagagcagttaatacacaggctctgagtggagcagga
atattgaggatggtgaacaaggctgccgacgctgtcaacaaaatgacaatcaagatgaat
gaatcggatgcatggtttgaagaaaagcagcagcaatttgagaatctggatcagcaactt
aggaaacttcatgtcagtgttgaagccttggtctgtcatagaaaagaactttcagccaac
acagctgcctttgctaaaagtgctgccatgttaggtaattctgaggatcatactgcttta
tctagagctttgtctcagcttgcagaggttgaggagaagatagaccagttacatcaagaa
caagcttttgctgacttttatatgttttcagaactacttagtgactacattcgtcttatt
gctgcagtgaaaggtgtgtttgaccatcgaatgaagtgctggcagaaatgggaagatgct
caaattactttgctcaaaaaacgtgaagctgaagcaaaaatgatggttgctaacaaacca
gataaaatacagcaagctaaaaatgaaataagagagtgggaggcgaaagtgcaacaaggg
gaaagagattttgaacagatatctaaaacgattcgaaaagaagtgggaagatttgagaaa
gaacgagtgaaggattttaaaaccgttatcatcaagtacttagaatcactagttcaaaca
caacaacagctgataaaatactgggaagcattcctacctgaagccaaagccattgcctag

DBGET integrated database retrieval system