KEGG   Homo sapiens (human): 6884
Entry
6884              CDS       T01001                                 

Gene name
TAF13, MRT60, TAF(II)18, TAF2K, TAFII-18, TAFII18
Definition
(RefSeq) TATA-box binding protein associated factor 13
  KO
K03127  transcription initiation factor TFIID subunit 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
Disease
H00768  Autosomal recessive mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    6884 (TAF13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    6884 (TAF13)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     6884 (TAF13)
SSDB
Motif
Pfam: TFIID-18kDa GTP_EFTU_D2
Other DBs
NCBI-GeneID: 6884
NCBI-ProteinID: NP_005636
OMIM: 600774
HGNC: 11546
Ensembl: ENSG00000197780
Vega: OTTHUMG00000042363
Pharos: Q15543(Tbio)
UniProt: Q15543 A0A024R089
LinkDB
Structure
PDB: 
1BH9 1BH8 6MZD 6MZL

Position
1p13.3
AA seq 124 aa
MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDL
VIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEA
NYGS
NT seq 375 nt   +upstreamnt  +downstreamnt
atggcagatgaggaagaagaccccacgtttgaggaagaaaatgaagaaattggaggaggt
gcagaaggtggacagggtaaaagaaagagacttttttctaaagaattgcgatgtatgatg
tatggctttggggatgaccagaatccttatactgagtcagtggatattcttgaagatctt
gtcatagagtttatcactgaaatgactcacaaggcaatgtcaattggaagacaaggtcga
gtacaagttgaagatatcgtcttcttgattcgaaaggacccaaggaagtttgccagggtt
aaagacttgcttactatgaatgaagaattgaaacgagctagaaaagcatttgatgaagca
aattatggatcttga

DBGET integrated database retrieval system