KEGG   Homo sapiens (human): 7003
Entry
7003              CDS       T01001                                 

Gene name
TEAD1, AA, NTEF-1, REF1, TCF-13, TCF13, TEAD-1, TEF-1
Definition
(RefSeq) TEA domain transcription factor 1
  KO
K09448  transcriptional enhancer factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
Disease
H01180  Sveinsson chorioretinal atrophy (SCRA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    7003 (TEAD1)
   04392 Hippo signaling pathway - multiple species
    7003 (TEAD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7003 (TEAD1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   TEA domain
    7003 (TEAD1)
SSDB
Motif
Pfam: YBD TEA
Other DBs
NCBI-GeneID: 7003
NCBI-ProteinID: NP_068780
OMIM: 189967
HGNC: 11714
Ensembl: ENSG00000187079
Vega: OTTHUMG00000165878
Pharos: P28347(Tbio)
UniProt: P28347 Q59EF3
LinkDB
Structure
PDB: 

Position
11p15.3
AA seq 426 aa
MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIIL
SDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSRDFHSKLKDQTAKDKALQ
HMAAMSSAQIVSATAIHNKLGLPGIPRPTFPGAPGFWPGMIQTGQPGSSQDVKPFVQQAY
PIQPAVTAPIPGFEPASAPAPSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSYNKHLFV
HIGHANHSYSDPLLESVDIRQIYDKFPEKKGGLKELFGKGPQNAFFLVKFWADLNCNIQD
DAGAFYGVTSQYESSENMTVTCSTKVCSFGKQVVEKVETEYARFENGRFVYRINRSPMCE
YMINFIHKLKHLPEKYMMNSVLENFTILLVVTNRDTQETLLCMACVFEVSNSEHGAQHHI
YRLVKD
NT seq 1281 nt   +upstreamnt  +downstreamnt
attgagcccagcagctggagcggcagtgagagccctgccgaaaacatggaaaggatgagt
gactctgcagataagccaattgacaatgatgcagaaggggtctggagccccgacatcgag
caaagctttcaggaggccctggctatctatccaccatgtgggaggaggaaaatcatctta
tcagacgaaggcaaaatgtatggtaggaatgaattgatagccagatacatcaaactcagg
acaggcaagacgaggaccagaaaacaggtgtctagtcacattcaggttcttgccagaagg
aaatctcgtgattttcattccaagctaaaggatcagactgcaaaggataaggccctgcag
cacatggcggccatgtcctcagcccagatcgtctcggccactgccattcataacaagctg
gggctgcctgggattccacgcccgaccttcccaggggcgccggggttctggccgggaatg
attcaaacagggcagccaggatcctcacaagacgtcaagccttttgtgcagcaggcctac
cccatccagccagcggtcacagcccccattccagggtttgagcctgcatcggccccagct
ccctcagtccctgcctggcaaggtcgctccattggcacaaccaagcttcgcctggtggaa
ttttcagcttttctcgagcagcagcgagacccagactcgtacaacaaacacctcttcgtg
cacattgggcatgccaaccattcttacagtgacccattgcttgaatcagtggacattcgt
cagatttatgacaaatttcctgaaaagaaaggtggcttaaaggaactgtttggaaagggc
cctcaaaatgccttcttcctcgtaaaattctgggctgatttaaactgcaatattcaagat
gatgctggggctttttatggtgtaaccagtcagtacgagagttctgaaaatatgacagtc
acctgttccaccaaagtttgctcctttgggaagcaagtagtagaaaaagtagagacggag
tatgcaaggtttgagaatggccgatttgtataccgaataaaccgctccccaatgtgtgaa
tatatgatcaacttcatccacaagctcaaacacttaccagagaaatatatgatgaacagt
gttttggaaaacttcacaattttattggtggtaacaaacagggatacacaagaaactcta
ctctgcatggcctgtgtgtttgaagtttcaaatagtgaacacggagcacaacatcatatt
tacaggcttgtaaaggactga

KEGG   Homo sapiens (human): 7004
Entry
7004              CDS       T01001                                 

Gene name
TEAD4, EFTR-2, RTEF1, TCF13L1, TEF-3, TEF3, TEFR-1, hRTEF-1B
Definition
(RefSeq) TEA domain transcription factor 4
  KO
K09448  transcriptional enhancer factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    7004 (TEAD4)
   04392 Hippo signaling pathway - multiple species
    7004 (TEAD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7004 (TEAD4)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   TEA domain
    7004 (TEAD4)
SSDB
Motif
Pfam: YBD TEA MSP1a
Other DBs
NCBI-GeneID: 7004
NCBI-ProteinID: NP_003204
OMIM: 601714
HGNC: 11717
Ensembl: ENSG00000197905
Vega: OTTHUMG00000168153
Pharos: Q15561(Tbio)
UniProt: Q15561
LinkDB
Structure
PDB: 

Position
12p13.33
AA seq 434 aa
MEGTAGTITSNEWSSPTSPEGSTASGGSQALDKPIDNDAEGVWSPDIEQSFQEALAIYPP
CGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQ
AAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPF
SQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPD
TYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWA
DLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYR
IHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSAS
EHGAQHHIYRLVKE
NT seq 1305 nt   +upstreamnt  +downstreamnt
ttggagggcacggccggcaccattacctccaacgagtggagctctcccacctcccctgag
gggagcaccgcctctgggggcagtcaggcactggacaagcccatcgacaatgacgcagag
ggcgtgtggagcccggatattgagcagagtttccaggaggccctcgccatctacccgccc
tgtggcaggcgcaaaatcatcctgtcggacgagggcaagatgtatggtcggaacgagctg
attgcccgctacatcaagctccggacagggaagacccgcaccaggaagcaggtctccagc
cacatccaggtgctggctcgtcgcaaagctcgcgagatccaggccaagctaaaggaccag
gcagctaaggacaaggccctgcagagcatggctgccatgtcgtctgcacagatcatctcc
gccacggccttccacagtagcatggccctcgcccggggccccggccgcccagcagtctca
gggttttggcaaggagctttgccaggccaagccggaacgtcccatgatgtgaagcctttc
tctcagcaaacctatgctgtccagcctccgctgcctctgccagggtttgagtctcctgca
gggcccgccccatcgccctctgcgcccccggcacccccatggcagggccgcagcgtggcc
agctccaagctctggatgttggagttctctgccttcctggagcagcagcaggacccggac
acgtacaacaagcacctgttcgtgcacattggccagtccagcccaagctacagcgacccc
tacctcgaagccgtggacatccgccaaatctatgacaaattcccggagaaaaagggtgga
ctcaaggatctcttcgaacggggaccctccaatgccttttttcttgtgaagttctgggca
gacctcaacaccaacatcgaggatgaaggcagctccttctatggggtctccagccagtat
gagagccccgagaacatgatcatcacctgctccacgaaggtctgctctttcggcaagcag
gtggtggagaaagttgagacagagtatgctcgctatgagaatggacactactcttaccgc
atccaccggtccccgctctgtgagtacatgatcaacttcatccacaagctcaagcacctc
cctgagaagtacatgatgaacagcgtgctggagaacttcaccatcctgcaggtggtcacc
aacagagacacacaggagaccttgctgtgcattgcctatgtctttgaggtgtcagccagt
gagcacggggctcagcaccacatctacaggctggtgaaagaatga

KEGG   Homo sapiens (human): 7005
Entry
7005              CDS       T01001                                 

Gene name
TEAD3, DTEF-1, ETFR-1, TEAD-3, TEAD5, TEF-5, TEF5
Definition
(RefSeq) TEA domain transcription factor 3
  KO
K09448  transcriptional enhancer factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    7005 (TEAD3)
   04392 Hippo signaling pathway - multiple species
    7005 (TEAD3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7005 (TEAD3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   TEA domain
    7005 (TEAD3)
SSDB
Motif
Pfam: YBD TEA
Other DBs
NCBI-GeneID: 7005
NCBI-ProteinID: NP_003205
OMIM: 603170
HGNC: 11716
Ensembl: ENSG00000007866
Vega: OTTHUMG00000014571
Pharos: Q99594(Tbio)
UniProt: Q99594
LinkDB
Structure
PDB: 
5EMW

Position
6p21.31
AA seq 435 aa
MASNSWNASSSPGEAREDGPEGLDKGLDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIIL
SDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARKKVREYQVGIKAMNLDQVSKD
KALQSMASMSSAQIVSASVLQNKFSPPSPLPQAVFSTSSRFWSSPPLLGQQPGPSQDIKP
FAQPAYPIQPPLPPTLSSYEPLAPLPSAAASVPVWQDRTIASSRLRLLEYSAFMEVQRDP
DTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFW
ADLNSTIQEGPGAFYGVSSQYSSADSMTISVSTKVCSFGKQVVEKVETEYARLENGRFVY
RIHRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTSRDSQETLLVIAFVFEVST
SEHGAQHHVYKLVKD
NT seq 1308 nt   +upstreamnt  +downstreamnt
atagcgtccaacagctggaacgccagcagcagccccggggaggcccgggaggatgggccc
gagggcctggacaaggggctggacaacgatgcggagggcgtgtggagcccggacatcgag
cagagcttccaggaggccctggccatctacccgccctgcggccggcggaagatcatcctg
tcagacgagggcaagatgtacggccgaaatgagttgattgcacgctatattaaactgagg
acggggaagactcggacgagaaaacaggtgtccagccacatacaggttctagctcggaag
aaggtgcgggagtaccaggttggcatcaaggccatgaacctggaccaggtctccaaggac
aaagcccttcagagcatggcgtccatgtcctctgcccagatcgtctctgccagtgtcctg
cagaacaagttcagcccaccttcccctctgccccaggccgtcttctccacttcctcgcgg
ttctggagcagcccccctctcctgggacagcagcctggaccctctcaggacatcaagccc
tttgcacagccagcctaccccatccagccgcccctgccgccgacgctcagcagttatgag
cccctggccccgctcccctcagctgctgcctctgtgcctgtgtggcaggaccgtaccatt
gcctcctcccggctgcggctcctggagtattcagccttcatggaggtgcagcgagaccct
gacacgtacagcaaacacctgtttgtgcacatcggccagacgaaccccgccttctcagac
ccacccctggaggcagtagatgtgcgccagatctatgacaaattccccgagaaaaaggga
ggattgaaggagctctatgagaaggggccccctaatgccttcttccttgtcaagttctgg
gccgacctcaacagcaccatccaggagggcccgggagccttctatggggtcagctctcag
tacagctctgctgatagcatgaccatcagcgtctccaccaaggtgtgctcctttggcaaa
caggtggtagagaaggtggagactgagtatgccaggctggagaacgggcgctttgtgtac
cgtatccaccgctcgcccatgtgcgagtacatgatcaacttcatccacaagctgaagcac
ctgcccgagaagtacatgatgaacagcgtgctggagaacttcaccatcctgcaggtggtc
acgagccgggactcccaggagaccctgcttgtcattgcttttgtcttcgaagtctccacc
agtgagcacggggcccagcaccatgtctacaagctcgtcaaagactag

KEGG   Homo sapiens (human): 8463
Entry
8463              CDS       T01001                                 

Gene name
TEAD2, ETF, TEAD-2, TEF-4, TEF4
Definition
(RefSeq) TEA domain transcription factor 2
  KO
K09448  transcriptional enhancer factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
hsa04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    8463 (TEAD2)
   04392 Hippo signaling pathway - multiple species
    8463 (TEAD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    8463 (TEAD2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   TEA domain
    8463 (TEAD2)
SSDB
Motif
Pfam: YBD TEA
Other DBs
NCBI-GeneID: 8463
NCBI-ProteinID: NP_003589
OMIM: 601729
HGNC: 11715
Ensembl: ENSG00000074219
Vega: OTTHUMG00000183174
Pharos: Q15562(Tbio)
UniProt: Q15562
LinkDB
Structure
PDB: 

Position
19q13.33
AA seq 447 aa
MGEPRAGAALDDGSGWTGSEEGSEEGTGGSEGAGGDGGPDAEGVWSPDIEQSFQEALAIY
PPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKSREIQSKLK
DQVSKDKAFQTMATMSSAQLISAPSLQAKLGPTGPQASELFQFWSGGSGPPWNVPDVKPF
SQTPFTLSLTPPSTDLPGYEPPQALSPLPPPTPSPPAWQARGLGTARLQLVEFSAFVEPP
DAVDSYQRHLFVHISQHCPSPGAPPLESVDVRQIYDKFPEKKGGLRELYDRGPPHAFFLV
KFWADLNWGPSGEEAGAGGSISSGGFYGVSSQYESLEHMTLTCSSKVCSFGKQVVEKVET
ERAQLEDGRFVYRLLRSPMCEYLVNFLHKLRQLPERYMMNSVLENFTILQVVTNRDTQEL
LLCTAYVFEVSTSERGAQHHIYRLVRD
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgggggaaccccgggctggggccgccctggacgatggcagcggctggacgggcagtgag
gaaggcagtgaggagggtaccggcggcagtgagggggctgggggtgacgggggcccggat
gcagagggggtgtggagcccagacattgagcagagcttccaggaggccctggccatctat
ccaccctgcggccgccggaaaataattttgtctgatgaaggcaagatgtatggtcggaat
gaactgatcgcccgctacatcaagctgagaacggggaagacccgaactcgaaaacaggtt
tctagtcacatccaggttttggcccgaaggaaatcaagggaaatccagtccaagttgaag
gaccaggtttccaaggacaaggctttccagacaatggcaaccatgtcctctgcccagctc
atctccgcgccttctctgcaggccaaactgggtcccactggtcctcaggcctctgagctt
ttccagttttggtctggaggatctgggcccccctggaatgttccagatgtgaagccattc
tcacagacaccgttcaccttgtcactgactcccccatctactgacctcccagggtacgag
cccccccaagccctctcacccctgcccccacctaccccatcgcccccagcctggcaggct
cggggcctgggcaccgcccggttgcagctggtagagttctcagccttcgtggaaccgcca
gatgcagttgattcttaccagaggcacctgttcgtgcacatcagccagcactgccccagc
cccggagcgccgccgctcgagagtgtggacgtccggcagatctacgacaaattccctgag
aaaaagggtggcctccgagagctatatgatcgtggccccccccatgccttcttcctggtc
aagttctgggcggacctgaactggggcccaagtggtgaggaggcaggggccggtggcagc
atcagcagtggtggcttctacggagtgagcagccagtatgagagcctggaacacatgacc
ctcacctgttcctccaaggtctgctcttttggcaagcaggtggtggagaaggtggagacg
gaacgggcccagctggaggacggcagatttgtgtaccgcctgctgcgctcgcccatgtgc
gagtacctggtgaatttcttgcacaagttgcggcagctgcctgagcgatacatgatgaac
agcgtcctggaaaacttcaccatcctccaggtggtgacaaacagagacacccaggaactg
ctgctctgcaccgcctatgtcttcgaggtctccaccagcgagcgtggggcccagcatcac
atttaccgcctggtcagggactga

DBGET integrated database retrieval system