KEGG   Homo sapiens (human): 7027
Entry
7027              CDS       T01001                                 
Symbol
TFDP1, DILC, DP1, DRTF1, Dp-1
Name
(RefSeq) transcription factor Dp-1
  KO
K04683  transcription factor Dp-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    7027 (TFDP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    7027 (TFDP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7027 (TFDP1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, DP
    7027 (TFDP1)
SSDB
Motif
Pfam: DP E2F_TDP
Other DBs
NCBI-GeneID: 7027
NCBI-ProteinID: NP_009042
OMIM: 189902
HGNC: 11749
Ensembl: ENSG00000198176
Vega: OTTHUMG00000017388
Pharos: Q14186(Tbio)
UniProt: Q14186 A0A024RDY4
Structure
LinkDB
Position
13:113584688..113641473
AA seq 410 aa
MAKDAGLIEANGELKVFIDQNLSPGKGVVSLVAVHPSTVNPLGKQLLPKTFGQSNVNIAQ
QVVIGTPQRPAASNTLVVGSPHTPSTHFASQNQPSDSSPWSAGKRNRKGEKNGKGLRHFS
MKVCEKVQRKGTTSYNEVADELVAEFSAADNHILPNESAYDQKNIRRRVYDALNVLMAMN
IISKEKKEIKWIGLPTNSAQECQNLEVERQRRLERIKQKQSQLQELILQQIAFKNLVQRN
RHAEQQASRPPPPNSVIHLPFIIVNTSKKTVIDCSISNDKFEYLFNFDNTFEIHDDIEVL
KRMGMACGLESGSCSAEDLKMARSLVPKALEPYVTEMAQGTVGGVFITTAGSTSNGTRFS
ASDLTNGADGMLATSSNGSQYSGSRVETPVSYVGEDDEEDDDFNENDEDD
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggcaaaagatgccggtctaattgaagccaacggagaactcaaggtcttcatagaccag
aaccttagtcccgggaaaggcgtggtgtccctcgtggccgttcacccctccaccgtcaac
ccgctcgggaagcagctcttgccaaaaacctttggacagtccaatgtcaacattgcccag
caagtggtaattggtacgcctcagagaccggcagcgtcaaacaccctggtggtaggaagc
ccacacacccccagcactcactttgcctctcagaaccagccttccgactcctcaccttgg
tctgccgggaagcgcaacaggaaaggagagaagaatggcaagggcctacggcatttctcc
atgaaggtctgcgagaaggtgcagaggaaagggaccacttcctacaacgaagtggcagac
gagctggttgcggagttcagtgctgccgacaaccacatcttaccaaacgagtcagcttat
gaccagaaaaacataagacggcgcgtctacgatgccttaaacgtgctaatggccatgaac
atcatctccaaggagaagaaggagatcaagtggattggtctgcccaccaactcggctcag
gaatgtcagaacttagaggtggaaagacagaggagacttgaaagaataaaacagaaacag
tctcaacttcaagaacttattctacagcaaattgccttcaagaacctggtgcagagaaac
cggcatgcggagcagcaggccagccggccaccgccacccaactcagtcatccacctgccc
ttcatcatcgtcaacaccagcaagaagacggtcatcgactgcagcatctccaatgacaaa
tttgagtatctgtttaattttgacaacacatttgaaatccacgatgacatagaagtgctg
aagcggatgggcatggcttgcgggctggagtcggggagctgctctgccgaagaccttaaa
atggccagaagtctggtccccaaggctctggagccatacgtgacagaaatggctcaggga
actgttggaggcgtgttcatcacgacggcaggttccacgtctaacggcacaaggttctct
gccagtgacctgaccaacggtgcagatgggatgctggccacaagctccaatgggtctcag
tacagcggctccagggtggagactccggtgtcctacgtcggggaggacgacgaggaggac
gatgacttcaacgagaatgacgaggacgactga

KEGG   Homo sapiens (human): 7029
Entry
7029              CDS       T01001                                 
Symbol
TFDP2, DP2
Name
(RefSeq) transcription factor Dp-2
  KO
K09392  transcription factor Dp-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    7029 (TFDP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7029 (TFDP2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, DP
    7029 (TFDP2)
SSDB
Motif
Pfam: DP E2F_TDP
Other DBs
NCBI-GeneID: 7029
NCBI-ProteinID: NP_001171610
OMIM: 602160
HGNC: 11751
Ensembl: ENSG00000114126
Vega: OTTHUMG00000164975
Pharos: Q14188(Tbio)
UniProt: Q14188
Structure
LinkDB
Position
3:complement(141944428..142149544)
AA seq 446 aa
MTAKNVGLTSTNAEVRGFIDQNLSPTKGNISFVAFPVSNTNSPTKILPKTLGPINVNVGP
QMIISTPQRLTSSGSVLIGSPYTPAPAMVTQTHIAEATGWVPGDRKRARKFIDSDFSESK
RSKKGDKNGKGLRHFSMKVCEKVQRKGTTSYNEVADELVSEFTNSNNHLAADSAYDQKNI
RRRVYDALNVLMAMNIISKEKKEIKWIGLPTNSAQECQNLEIEKQRRIERIKQKRAQLQE
LLLQQIAFKNLVQRNRQNEQQNQGPPALNSTIQLPFIIINTSRKTVIDCSISSDKFEYLF
NFDNTFEIHDDIEVLKRMGMSFGLESGKCSLEDLKLAKSLVPKALEGYITDISTGPSWLN
QGLLLNSTQSVSNLDLTTGATLPQSSVNQGLCLDAEVALATGQFLAPNSHQSSSAASHCS
ESRGETPCSFNDEDEEDDEEDSSSPE
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgacggcaaaaaatgttggtttgacttccacaaatgcagaagtaagaggatttatagat
cagaatctcagtccaacaaaaggcaacatttcatttgttgcatttccagtttccaatacc
aactcacctacaaagattttaccaaaaaccttaggaccaataaatgtgaatgttggaccc
caaatgattataagcacaccacagagactaaccagttcaggaagtgttctgattgggagt
ccatatacccctgcaccagcaatggttactcagacacacatagcagaagctactggctgg
gtccctggtgatagaaaacgggctagaaaatttatagactctgatttttcagaaagtaaa
cgaagcaaaaaaggagataaaaatgggaaaggcttgagacacttttcaatgaaagtgtgt
gagaaagttcaacgaaaaggtacaacatcgtacaatgaagtcgctgatgagctggtgtca
gagttcaccaattcaaataaccatttggctgctgattcggcttatgatcagaagaacatt
aggcgaagagtttatgatgctttaaatgtgctaatggcaatgaacataatttcaaaggaa
aaaaaagaaatcaagtggattggcctgcctaccaattctgctcaggaatgtcagaatctg
gagatagagaagcagaggcggatagaacggataaagcagaagcgggcccagctgcaagaa
cttctcctacagcaaatcgctttcaaaaacctggtacagagaaatcgacaaaatgagcag
caaaaccagggcccgccggctctgaactctaccattcagctgccattcataatcatcaat
acaagcagaaaaacagtcatagattgcagcatctccagtgacaagtttgagtatcttttc
aattttgacaacacctttgagatccatgatgacatagaagtactaaagcggatgggaatg
tcgtttggcctggagtcaggcaaatgctctctggaggatctgaaacttgcgaaatccctg
gtgccaaaggctttagaaggttatatcacagatatctccacaggaccttcttggttaaat
cagggactacttctgaactctacccaatcagtttcaaatttagacctgaccactggtgcc
accttaccccagtcaagtgtaaaccaagggttatgcttggatgcagaagtggccttagca
actgggcagttcctggccccaaacagtcaccagtccagcagtgcggcctctcactgctcc
gagtcccgaggcgagaccccctgttcgttcaatgatgaagatgaggaagatgatgaggag
gattcctcctccccagaataa

DBGET integrated database retrieval system