KEGG   Homo sapiens (human): 713
Entry
713               CDS       T01001                                 

Gene name
C1QB
Definition
(RefSeq) complement C1q B chain
  KO
K03987  complement C1q subcomponent subunit B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion disease
hsa05133  Pertussis
hsa05142  Chagas disease
hsa05150  Staphylococcus aureus infection
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01313  Classical pathway of complement activation
N01314  SARS-CoV-2 S to classical pathway of complement activation
Disease
H00102  Classic complement pathway component defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    713 (C1QB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    713 (C1QB)
  09171 Infectious disease: bacterial
   05133 Pertussis
    713 (C1QB)
   05150 Staphylococcus aureus infection
    713 (C1QB)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    713 (C1QB)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    713 (C1QB)
  09164 Neurodegenerative disease
   05020 Prion disease
    713 (C1QB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    713 (C1QB)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    713 (C1QB)
SSDB
Motif
Pfam: C1q Collagen BclA_C
Other DBs
NCBI-GeneID: 713
NCBI-ProteinID: NP_000482
OMIM: 120570
HGNC: 1242
Ensembl: ENSG00000173369
Vega: OTTHUMG00000002896
Pharos: P02746(Tbio)
UniProt: P02746 A0A024RAB9
LinkDB
Structure
PDB: 

Position
1p36.12
AA seq 253 aa
MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKG
EKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQ
KIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNL
CVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANS
IFSGFLLFPDMEA
NT seq 762 nt   +upstreamnt  +downstreamnt
atgatgatgaagatcccatggggcagcatcccagtactgatgttgctcctgctcctgggc
ctaatcgatatctcccaggcccagctcagctgcaccgggcccccagccatccctggcatc
ccgggtatccctgggacacctggccccgatggccaacctgggaccccagggataaaagga
gagaaagggcttccagggctggctggagaccatggtgagttcggagagaagggagaccca
gggattcctgggaatccaggaaaagtcggccccaagggccccatgggccctaaaggtggc
ccaggggcccctggagccccaggccccaaaggtgaatcgggagactacaaggccacccag
aaaatcgccttctctgccacaagaaccatcaacgtccccctgcgccgggaccagaccatc
cgcttcgaccacgtgatcaccaacatgaacaacaattatgagccccgcagtggcaagttc
acctgcaaggtgcccggtctctactacttcacctaccacgccagctctcgagggaacctg
tgcgtgaacctcatgcgtggccgggagcgtgcacagaaggtggtcaccttctgtgactat
gcctacaacaccttccaggtcaccaccggtggcatggtcctcaagctggagcagggggag
aacgtcttcctgcaggccaccgacaagaactcactactgggcatggagggtgccaacagc
atcttttccgggttcctgctctttccagatatggaggcctga

DBGET integrated database retrieval system