KEGG   Homo sapiens (human): 717
Entry
717               CDS       T01001                                 

Symbol
C2, ARMD14, CO2
Name
(RefSeq) complement C2
  KO
K01332  complement component 2 [EC:3.4.21.43]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa04936  Alcoholic liver disease
hsa05133  Pertussis
hsa05150  Staphylococcus aureus infection
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01311  Lectin pathway of complement activation
N01312  SARS-CoV-2 S to lectin pathway of complement activation
N01313  Classical pathway of complement activation
N01314  SARS-CoV-2 S to classical pathway of complement activation
Disease
H00080  Systemic lupus erythematosus
H00102  Classic complement pathway component defects
H00821  Age-related macular degeneration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    717 (C2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    717 (C2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    717 (C2)
   05150 Staphylococcus aureus infection
    717 (C2)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    717 (C2)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    717 (C2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    717 (C2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.43  classical-complement-pathway C3/C5 convertase
     717 (C2)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   717 (C2)
SSDB
Motif
Pfam: VWA Trypsin Sushi VWA_2 DUF1986 HRM Trypsin_2
Other DBs
NCBI-GeneID: 717
NCBI-ProteinID: NP_000054
OMIM: 613927
HGNC: 1248
Ensembl: ENSG00000166278
Vega: OTTHUMG00000031190
Pharos: P06681(Tbio)
UniProt: P06681 Q5JP69 Q53HP3
LinkDB
Structure
PDB: 
3ERB 2ODP 2I6Q 2ODQ 2I6S

Position
6p21.33
AA seq 752 aa
MGPLMVLFCLLFLYPGLADSAPSCPQNVNISGGTFTLSHGWAPGSLLTYSCPQGLYPSPA
SRLCKSSGQWQTPGATRSLSKAVCKPVRCPAPVSFENGIYTPRLGSYPVGGNVSFECEDG
FILRGSPVRQCRPNGMWDGETAVCDNGAGHCPNPGISLGAVRTGFRFGHGDKVRYRCSSN
LVLTGSSERECQGNGVWSGTEPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKES
LGRKIQIQRSGHLNLYLLLDCSQSVSENDFLIFKESASLMVDRIFSFEINVSVAIITFAS
EPKVLMSVLNDNSRDMTEVISSLENANYKDHENGTGTNTYAALNSVYLMMNNQMRLLGME
TMAWQEIRHAIILLTDGKSNMGGSPKTAVDHIREILNINQKRNDYLDIYAIGVGKLDVDW
RELNELGSKKDGERHAFILQDTKALHQVFEHMLDVSKLTDTICGVGNMSANASDQERTPW
HVTIKPKSQETCRGALISDQWVLTAAHCFRDGNDHSLWRVNVGDPKSQWGKEFLIEKAVI
SPGFDVFAKKNQGILEFYGDDIALLKLAQKVKMSTHARPICLPCTMEANLALRRPQGSTC
RDHENELLNKQSVPAHFVALNGSKLNINLKMGVEWTSCAEVVSQEKTMFPNLTDVREVVT
DQFLCSGTQEDESPCKGESGGAVFLERRFRFFQVGLVSWGLYNPCLGSADKNSRKRAPRS
KVPPPRDFHINLFRMQPWLRQHLGDVLNFLPL
NT seq 2259 nt   +upstreamnt  +downstreamnt
atgggcccactgatggttcttttttgcctgctgttcctgtacccaggtctggcagactcg
gctccctcctgccctcagaacgtgaatatctcgggtggcaccttcaccctcagccatggc
tgggctcctgggagccttctcacctactcctgcccccagggcctgtacccatccccagca
tcacggctgtgcaagagcagcggacagtggcagaccccaggagccacccggtctctgtct
aaggcggtctgcaaacctgtgcgctgtccagcccctgtctcctttgagaatggcatttat
accccacggctggggtcctatcccgtgggtggcaatgtgagcttcgagtgtgaggatggc
ttcatattgcggggctcgcctgtgcgtcagtgtcgccccaacggcatgtgggatggagaa
acagctgtgtgtgataatggggctggccactgccccaacccaggcatttcactgggcgca
gtgcggacaggcttccgctttggtcatggggacaaggtccgctatcgctgctcctcgaat
cttgtgctcacggggtcttcggagcgggagtgccagggcaacggggtctggagtggaacg
gagcccatctgccgccaaccctactcttatgacttccctgaggacgtggcccctgccctg
ggcacttccttctcccacatgcttggggccaccaatcccacccagaagacaaaggaaagc
ctgggccgtaaaatccaaatccagcgctctggtcatctgaacctctacctgctcctggac
tgttcgcagagtgtgtcggaaaatgactttctcatcttcaaggagagcgcctccctcatg
gtggacaggatcttcagctttgagatcaatgtgagcgttgccattatcacctttgcctca
gagcccaaagtcctcatgtctgtcctgaacgacaactcccgggatatgactgaggtgatc
agcagcctggaaaatgccaactataaagatcatgaaaatggaactgggactaacacctat
gcggccttaaacagtgtctatctcatgatgaacaaccaaatgcgactcctcggcatggaa
acgatggcctggcaggaaatccgacatgccatcatccttctgacagatggaaagtccaat
atgggtggctctcccaagacagctgttgaccatatcagagagatcctgaacatcaaccag
aagaggaatgactatctggacatctatgccatcggggtgggcaagctggatgtggactgg
agagaactgaatgagctagggtccaagaaggatggtgagaggcatgccttcattctgcag
gacacaaaggctctgcaccaggtctttgaacatatgctggatgtctccaagctcacagac
accatctgcggggtggggaacatgtcagcaaacgcctctgaccaggagaggacaccctgg
catgtcactattaagcccaagagccaagagacctgccggggggccctcatctccgaccaa
tgggtcctgacagcagctcattgcttccgcgatggcaacgaccactccctgtggagggtc
aatgtgggagaccccaaatcccagtggggcaaagaattccttattgagaaggcggtgatc
tccccagggtttgatgtctttgccaaaaagaaccagggaatcctggagttctatggtgat
gacatagctctgctgaagctggcccagaaagtaaagatgtccacccatgccaggcccatc
tgccttccctgcacgatggaggccaatctggctctgcggagacctcaaggcagcacctgt
agggaccatgagaatgaactgctgaacaaacagagtgttcctgctcattttgtcgccttg
aatgggagcaaactgaacattaaccttaagatgggagtggagtggacaagctgtgccgag
gttgtctcccaagaaaaaaccatgttccccaacttgacagatgtcagggaggtggtgaca
gaccagttcctatgcagtgggacccaggaggatgagagtccctgcaagggagaatctggg
ggagcagttttccttgagcggagattcaggttttttcaggtgggtctggtgagctggggt
ctttacaacccctgccttggctctgctgacaaaaactcccgcaaaagggcccctcgtagc
aaggtcccgccgccacgagactttcacatcaatctcttccgcatgcagccctggctgagg
cagcacctgggggatgtcctgaattttttacccctctag

KEGG   Homo sapiens (human): 720
Entry
720               CDS       T01001                                 

Symbol
C4A, C4, C4A2, C4A3, C4A4, C4A6, C4AD, C4S, CO4, CPAMD2, RG
Name
(RefSeq) complement C4A (Rodgers blood group)
  KO
K03989  complement component 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa04936  Alcoholic liver disease
hsa05133  Pertussis
hsa05150  Staphylococcus aureus infection
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01311  Lectin pathway of complement activation
N01312  SARS-CoV-2 S to lectin pathway of complement activation
N01313  Classical pathway of complement activation
N01314  SARS-CoV-2 S to classical pathway of complement activation
Disease
H00080  Systemic lupus erythematosus
H00102  Classic complement pathway component defects
H01649  Schizophrenia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    720 (C4A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    720 (C4A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    720 (C4A)
   05150 Staphylococcus aureus infection
    720 (C4A)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    720 (C4A)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    720 (C4A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    720 (C4A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    720 (C4A)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   720 (C4A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   720 (C4A)
  Exosomal proteins of other cancer cells
   720 (C4A)
SSDB
Motif
Pfam: TED_complement A2M_recep A2M A2M_BRD NTR MG3 MG2 ANATO MG4 Big_1 Prenyltrans SQHop_cyclase_C
Other DBs
NCBI-GeneID: 720
NCBI-ProteinID: NP_009224
OMIM: 120810
HGNC: 1323
Ensembl: ENSG00000244731
Vega: OTTHUMG00000031186
UniProt: P0C0L4
LinkDB
Structure
PDB: 

Position
6p21.33
AA seq 1744 aa
MRLLWGLIWASSFFTLSLQKPRLLLFSPSVVHLGVPLSVGVQLQDVPRGQVVKGSVFLRN
PSRNNVPCSPKVDFTLSSERDFALLSLQVPLKDAKSCGLHQLLRGPEVQLVAHSPWLKDS
LSRTTNIQGINLLFSSRRGHLFLQTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVEN
SHGLRVRKKEVYMPSSIFQDDFVIPDISEPGTWKISARFSDGLESNSSTQFEVKKYVLPN
FEVKITPGKPYILTVPGHLDEMQLDIQARYIYGKPVQGVAYVRFGLLDEDGKKTFFRGLE
SQTKLVNGQSHISLSKAEFQDALEKLNMGITDLQGLRLYVAAAIIESPGGEMEEAELTSW
YFVSSPFSLDLSKTKRHLVPGAPFLLQALVREMSGSPASGIPVKVSATVSSPGSVPEVQD
IQQNTDGSGQVSIPIIIPQTISELQLSVSAGSPHPAIARLTVAAPPSGGPGFLSIERPDS
RPPRVGDTLNLNLRAVGSGATFSHYYYMILSRGQIVFMNREPKRTLTSVSVFVDHHLAPS
FYFVAFYYHGDHPVANSLRVDVQAGACEGKLELSVDGAKQYRNGESVKLHLETDSLALVA
LGALDTALYAAGSKSHKPLNMGKVFEAMNSYDLGCGPGGGDSALQVFQAAGLAFSDGDQW
TLSRKRLSCPKEKTTRKKRNVNFQKAINEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRA
ARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQRALEILQEEDLIDEDDIPVRSFFPE
NWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLP
MSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFS
VVPTAAAAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEI
PGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAP
TLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRDSSTWLTA
FVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDPCPVLDRSMQGGLVGNDETVA
LTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKANSFLGEKASAGLLGAHAAAITAYAL
TLTKAPVDLLGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPAL
WIETTAYALLHLLLHEGKAEMADQASAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASH
TTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKV
LRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPLQPVTP
LQLFEGRRNRRRREAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRAD
LEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYY
NPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYY
PRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPG
KEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQ
GCQV
NT seq 5235 nt   +upstreamnt  +downstreamnt
atgaggctgctctgggggctgatctgggcatccagcttcttcaccttatctctgcagaag
cccaggttgctcttgttctctccttctgtggttcatctgggggtccccctatcggtgggg
gtgcagctccaggatgtgccccgaggacaggtagtgaaaggatcagtgttcctgagaaac
ccatctcgtaataatgtcccctgctccccaaaggtggacttcacccttagctcagaaaga
gacttcgcactcctcagtctccaggtgcccttgaaagatgcgaagagctgtggcctccat
caactcctcagaggccctgaggtccagctggtggcccattcgccatggctaaaggactct
ctgtccagaacgacaaacatccagggtatcaacctgctcttctcctctcgccgggggcac
ctctttttgcagacggaccagcccatttacaaccctggccagcgggttcggtaccgggtc
tttgctctggatcagaagatgcgcccgagcactgacaccatcacagtcatggtggagaac
tctcacggcctccgcgtgcggaagaaggaggtgtacatgccctcgtccatcttccaggat
gactttgtgatcccagacatctcagagccagggacctggaagatctcagcccgattctca
gatggcctggaatccaacagcagcacccagtttgaggtgaagaaatatgtccttcccaac
tttgaggtgaagatcacccctggaaagccctacatcctgacggtgccaggccatcttgat
gaaatgcagttagacatccaggccaggtacatctatgggaagccagtgcagggggtggca
tatgtgcgctttgggctcctagatgaggatggtaagaagactttctttcgggggctggag
agtcagaccaagctggtgaatggacagagccacatttccctctcaaaggcagagttccag
gacgccctggagaagctgaatatgggcattactgacctccaggggctgcgcctctacgtt
gctgcagccatcattgagtctccaggtggggagatggaggaggcagagctcacatcctgg
tattttgtgtcatctcccttctccttggatcttagcaagaccaagcgacaccttgtgcct
ggggcccccttcctgctgcaggccttggtccgtgagatgtcaggctccccagcttctggc
attcctgtcaaagtttctgccacggtgtcttctcctgggtctgttcctgaagtccaggac
attcagcaaaacacagacgggagcggccaagtcagcattccaataattatccctcagacc
atctcagagctgcagctctcagtatctgcaggctccccacatccagcgatagccaggctc
actgtggcagccccaccttcaggaggccccgggtttctgtctattgagcggccggattct
cgacctcctcgtgttggggacactctgaacctgaacttgcgagccgtgggcagtggggcc
accttttctcattactactacatgatcctatcccgagggcagatcgtgttcatgaatcga
gagcccaagaggaccctgacctcggtctcggtgtttgtggaccatcacctggcaccctcc
ttctactttgtggccttctactaccatggagaccacccagtggccaactccctgcgagtg
gatgtccaggctggggcctgcgagggcaagctggagctcagcgtggacggtgccaagcag
taccggaacggggagtccgtgaagctccacttagaaaccgactccctagccctggtggcg
ctgggagccttggacacagctctgtatgctgcaggcagcaagtcccacaagcccctcaac
atgggcaaggtctttgaagctatgaacagctatgacctcggctgtggtcctgggggtggg
gacagtgcccttcaggtgttccaggcagcgggcctggccttttctgatggagaccagtgg
accttatccagaaagagactaagctgtcccaaggagaagacaacccggaaaaagagaaac
gtgaacttccaaaaggcgattaatgagaaattgggtcagtatgcttccccgacagccaag
cgctgctgccaggatggggtgacacgtctgcccatgatgcgttcctgcgagcagcgggca
gcccgcgtgcagcagccggactgccgggagcccttcctgtcctgctgccaatttgctgag
agtctgcgcaagaagagcagggacaagggccaggcgggcctccaacgagccctggagatc
ctgcaggaggaggacctgattgatgaggatgacattcccgtgcgcagcttcttcccagag
aactggctctggagagtggaaacagtggaccgctttcaaatattgacactgtggctcccc
gactctctgaccacgtgggagatccatggcctgagcctgtccaaaaccaaaggcctatgt
gtggccaccccagtccagctccgggtgttccgcgagttccacctgcacctccgcctgccc
atgtctgtccgccgctttgagcagctggagctgcggcctgtcctctataactacctggat
aaaaacctgactgtgagcgtccacgtgtccccagtggaggggctgtgcctggctgggggc
ggagggctggcccagcaggtgctggtgcctgcgggctctgcccggcctgttgccttctct
gtggtgcccacggcagccgccgctgtgtctctgaaggtggtggctcgagggtccttcgaa
ttccctgtgggagatgcggtgtccaaggttctgcagattgagaaggaaggggccatccat
agagaggagctggtctatgaactcaaccccttggaccaccgaggccggaccttggaaata
cctggcaactctgatcccaatatgatccctgatggggactttaacagctacgtcagggtt
acagcctcagatccattggacactttaggctctgagggggccttgtcaccaggaggcgtg
gcctccctcttgaggcttcctcgaggctgtggggagcaaaccatgatctacttggctccg
acactggctgcttcccgctacctggacaagacagagcagtggagcacactgcctcccgag
accaaggaccacgccgtggatctgatccagaaaggctacatgcggatccagcagtttcgg
aaggcggatggttcctatgcggcttggttgtcacgggacagcagcacctggctcacagcc
tttgtgttgaaggtcctgagtttggcccaggagcaggtaggaggctcgcctgagaaactg
caggagacatctaactggcttctgtcccagcagcaggctgacggctcgttccaggacccc
tgtccagtgttagacaggagcatgcaggggggtttggtgggcaatgatgagactgtggca
ctcacagcctttgtgaccatcgcccttcatcatgggctggccgtcttccaggatgagggt
gcagagccattgaagcagagagtggaagcctccatctcaaaggcaaactcatttttgggg
gagaaagcaagtgctgggctcctgggtgcccacgcagctgccatcacggcctatgccctg
acactgaccaaggcgcctgtggacctgctcggtgttgcccacaacaacctcatggcaatg
gcccaggagactggagataacctgtactggggctcagtcactggttctcagagcaatgcc
gtgtcgcccaccccggctcctcgcaacccatccgaccccatgccccaggccccagccctg
tggattgaaaccacagcctacgccctgctgcacctcctgcttcacgagggcaaagcagag
atggcagaccaggcttcggcctggctcacccgtcagggcagcttccaagggggattccgc
agtacccaagacacggtgattgccctggatgccctgtctgcctactggattgcctcccac
accactgaggagaggggtctcaatgtgactctcagctccacaggccggaatgggttcaag
tcccacgcgctgcagctgaacaaccgccagattcgcggcctggaggaggagctgcagttt
tccttgggcagcaagatcaatgtgaaggtgggaggaaacagcaaaggaaccctgaaggtc
cttcgtacctacaatgtcctggacatgaagaacacgacctgccaggacctacagatagaa
gtgacagtcaaaggccacgtcgagtacacgatggaagcaaacgaggactatgaggactat
gagtacgatgagcttccagccaaggatgacccagatgcccctctgcagcccgtgacaccc
ctgcagctgtttgagggtcggaggaaccgccgcaggagggaggcgcccaaggtggtggag
gagcaggagtccagggtgcactacaccgtgtgcatctggcggaacggcaaggtggggctg
tctggcatggccatcgcggacgtcaccctcctgagtggattccacgccctgcgtgctgac
ctggagaagctgacctccctctctgaccgttacgtgagtcactttgagaccgaggggccc
cacgtcctgctgtattttgactcggtccccacctcccgggagtgcgtgggctttgaggct
gtgcaggaagtgccggtggggctggtgcagccggccagcgcaaccctgtacgactactac
aaccccgagcgcagatgttctgtgttttacggggcaccaagtaagagcagactcttggcc
accttgtgttctgctgaagtctgccagtgtgctgaggggaagtgccctcgccagcgtcgc
gccctggagcggggtctgcaggacgaggatggctacaggatgaagtttgcctgctactac
ccccgtgtggagtacggcttccaggttaaggttctccgagaagacagcagagctgctttc
cgcctctttgagaccaagatcacccaagtcctgcacttcaccaaggatgtcaaggccgct
gctaatcagatgcgcaacttcctggttcgagcctcctgccgccttcgcttggaacctggg
aaagaatatttgatcatgggtctggatggggccacctatgacctcgagggacacccccag
tacctgctggactcgaatagctggatcgaggagatgccctctgaacgcctgtgccggagc
acccgccagcgggcagcctgtgcccagctcaacgacttcctccaggagtatggcactcag
gggtgccaggtgtga

KEGG   Homo sapiens (human): 721
Entry
721               CDS       T01001                                 

Symbol
C4B, C4B1, C4B12, C4B2, C4B3, C4B5, C4BD, C4B_2, C4F, CH, CO4, CPAMD3
Name
(RefSeq) complement C4B (Chido blood group)
  KO
K03989  complement component 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa04936  Alcoholic liver disease
hsa05133  Pertussis
hsa05150  Staphylococcus aureus infection
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01311  Lectin pathway of complement activation
N01312  SARS-CoV-2 S to lectin pathway of complement activation
N01313  Classical pathway of complement activation
N01314  SARS-CoV-2 S to classical pathway of complement activation
Disease
H00102  Classic complement pathway component defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    721 (C4B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    721 (C4B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    721 (C4B)
   05150 Staphylococcus aureus infection
    721 (C4B)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    721 (C4B)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    721 (C4B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    721 (C4B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    721 (C4B)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   721 (C4B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   721 (C4B)
  Exosomal proteins of other cancer cells
   721 (C4B)
SSDB
Motif
Pfam: TED_complement A2M_recep A2M A2M_BRD NTR MG3 MG2 ANATO MG4 Big_1 Prenyltrans
Other DBs
NCBI-GeneID: 721
NCBI-ProteinID: NP_001002029
OMIM: 120820
HGNC: 1324
Ensembl: ENSG00000224389
Vega: OTTHUMG00000031187
Pharos: P0C0L5(Tbio) P0C0L4(Tbio)
UniProt: P0C0L4 P0C0L5
LinkDB
Structure
PDB: 

Position
6p21.33
AA seq 1744 aa
MRLLWGLIWASSFFTLSLQKPRLLLFSPSVVHLGVPLSVGVQLQDVPRGQVVKGSVFLRN
PSRNNVPCSPKVDFTLSSERDFALLSLQVPLKDAKSCGLHQLLRGPEVQLVAHSPWLKDS
LSRTTNIQGINLLFSSRRGHLFLQTDQPIYNPGQRVRYRVFALDQKMRPSTDTITVMVEN
SHGLRVRKKEVYMPSSIFQDDFVIPDISEPGTWKISARFSDGLESNSSTQFEVKKYVLPN
FEVKITPGKPYILTVPGHLDEMQLDIQARYIYGKPVQGVAYVRFGLLDEDGKKTFFRGLE
SQTKLVNGQSHISLSKAEFQDALEKLNMGITDLQGLRLYVAAAIIESPGGEMEEAELTSW
YFVSSPFSLDLSKTKRHLVPGAPFLLQALVREMSGSPASGIPVKVSATVSSPGSVPEVQD
IQQNTDGSGQVSIPIIIPQTISELQLSVSAGSPHPAIARLTVAAPPSGGPGFLSIERPDS
RPPRVGDTLNLNLRAVGSGATFSHYYYMILSRGQIVFMNREPKRTLTSVSVFVDHHLAPS
FYFVAFYYHGDHPVANSLRVDVQAGACEGKLELSVDGAKQYRNGESVKLHLETDSLALVA
LGALDTALYAAGSKSHKPLNMGKVFEAMNSYDLGCGPGGGDSALQVFQAAGLAFSDGDQW
TLSRKRLSCPKEKTTRKKRNVNFQKAINEKLGQYASPTAKRCCQDGVTRLPMMRSCEQRA
ARVQQPDCREPFLSCCQFAESLRKKSRDKGQAGLQRALEILQEEDLIDEDDIPVRSFFPE
NWLWRVETVDRFQILTLWLPDSLTTWEIHGLSLSKTKGLCVATPVQLRVFREFHLHLRLP
MSVRRFEQLELRPVLYNYLDKNLTVSVHVSPVEGLCLAGGGGLAQQVLVPAGSARPVAFS
VVPTAATAVSLKVVARGSFEFPVGDAVSKVLQIEKEGAIHREELVYELNPLDHRGRTLEI
PGNSDPNMIPDGDFNSYVRVTASDPLDTLGSEGALSPGGVASLLRLPRGCGEQTMIYLAP
TLAASRYLDKTEQWSTLPPETKDHAVDLIQKGYMRIQQFRKADGSYAAWLSRGSSTWLTA
FVLKVLSLAQEQVGGSPEKLQETSNWLLSQQQADGSFQDLSPVIHRSMQGGLVGNDETVA
LTAFVTIALHHGLAVFQDEGAEPLKQRVEASISKASSFLGEKASAGLLGAHAAAITAYAL
TLTKAPADLRGVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPRNPSDPMPQAPAL
WIETTAYALLHLLLHEGKAEMADQAAAWLTRQGSFQGGFRSTQDTVIALDALSAYWIASH
TTEERGLNVTLSSTGRNGFKSHALQLNNRQIRGLEEELQFSLGSKINVKVGGNSKGTLKV
LRTYNVLDMKNTTCQDLQIEVTVKGHVEYTMEANEDYEDYEYDELPAKDDPDAPLQPVTP
LQLFEGRRNRRRREAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRAD
LEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYY
NPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYY
PRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPG
KEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQ
GCQV
NT seq 5235 nt   +upstreamnt  +downstreamnt
atgaggctgctctgggggctgatctgggcatccagcttcttcaccttatctctgcagaag
cccaggttgctcttgttctctccttctgtggttcatctgggggtccccctatcggtgggg
gtgcagctccaggatgtgccccgaggacaggtagtgaaaggatcagtgttcctgagaaac
ccatctcgtaataatgtcccctgctccccaaaggtggacttcacccttagctcagaaaga
gacttcgcactcctcagtctccaggtgcccttgaaagatgcgaagagctgtggcctccat
caactcctcagaggccctgaggtccagctggtggcccattcgccatggctaaaggactct
ctgtccagaacgacaaacatccagggtatcaacctgctcttctcctctcgccgggggcac
ctctttttgcagacggaccagcccatttacaaccctggccagcgggttcggtaccgggtc
tttgctctggatcagaagatgcgcccgagcactgacaccatcacagtcatggtggagaac
tctcacggcctccgcgtgcggaagaaggaggtgtacatgccctcgtccatcttccaggat
gactttgtgatcccagacatctcagagccagggacctggaagatctcagcccgattctca
gatggcctggaatccaacagcagcacccagtttgaggtgaagaaatatgtccttcccaac
tttgaggtgaagatcacccctggaaagccctacatcctgacggtgccaggccatcttgat
gaaatgcagttagacatccaggccaggtacatctatgggaagccagtgcagggggtggca
tatgtgcgctttgggctcctagatgaggatggtaagaagactttctttcgggggctggag
agtcagaccaagctggtgaatggacagagccacatttccctctcaaaggcagagttccag
gacgccctggagaagctgaatatgggcattactgacctccaggggctgcgcctctacgtt
gctgcagccatcattgagtctccaggtggggagatggaggaggcagagctcacatcctgg
tattttgtgtcatctcccttctccttggatcttagcaagaccaagcgacaccttgtgcct
ggggcccccttcctgctgcaggccttggtccgtgagatgtcaggctccccagcttctggc
attcctgtcaaagtttctgccacggtgtcttctcctgggtctgttcctgaagtccaggac
attcagcaaaacacagacgggagcggccaagtcagcattccaataattatccctcagacc
atctcagagctgcagctctcagtatctgcaggctccccacatccagcgatagccaggctc
actgtggcagccccaccttcaggaggccccgggtttctgtctattgagcggccggattct
cgacctcctcgtgttggggacactctgaacctgaacttgcgagccgtgggcagtggggcc
accttttctcattactactacatgatcctatcccgagggcagatcgtgttcatgaatcga
gagcccaagaggaccctgacctcggtctcggtgtttgtggaccatcacctggcaccctcc
ttctactttgtggccttctactaccatggagaccacccagtggccaactccctgcgagtg
gatgtccaggctggggcctgcgagggcaagctggagctcagcgtggacggtgccaagcag
taccggaacggggagtccgtgaagctccacttagaaaccgactccctagccctggtggcg
ctgggagccttggacacagctctgtatgctgcaggcagcaagtcccacaagcccctcaac
atgggcaaggtctttgaagctatgaacagctatgacctcggctgtggtcctgggggtggg
gacagtgcccttcaggtgttccaggcagcgggcctggccttttctgatggagaccagtgg
accttatccagaaagagactaagctgtcccaaggagaagacaacccggaaaaagagaaac
gtgaacttccaaaaggcgattaatgagaaattgggtcagtatgcttccccgacagccaag
cgctgctgccaggatggggtgacacgtctgcccatgatgcgttcctgcgagcagcgggca
gcccgcgtgcagcagccggactgccgggagcccttcctgtcctgctgccaatttgctgag
agtctgcgcaagaagagcagggacaagggccaggcgggcctccaacgagccctggagatc
ctgcaggaggaggacctgattgatgaggatgacattcccgtgcgcagcttcttcccagag
aactggctctggagagtggaaacagtggaccgctttcaaatattgacactgtggctcccc
gactctctgaccacgtgggagatccatggcctgagcctgtccaaaaccaaaggcctatgt
gtggccaccccagtccagctccgggtgttccgcgagttccacctgcacctccgcctgccc
atgtctgtccgccgctttgagcagctggagctgcggcctgtcctctataactacctggat
aaaaacctgactgtgagcgtccacgtgtccccagtggaggggctgtgcctggctgggggc
ggagggctggcccagcaggtgctggtgcctgcgggctctgcccggcctgttgccttctct
gtggtgcccacggcagccaccgctgtgtctctgaaggtggtggctcgagggtccttcgaa
ttccctgtgggagatgcggtgtccaaggttctgcagattgagaaggaaggggccatccat
agagaggagctggtctatgaactcaaccccttggaccaccgaggccggaccttggaaata
cctggcaactctgatcccaatatgatccctgatggggactttaacagctacgtcagggtt
acagcctcagatccattggacactttaggctctgagggggccttgtcaccaggaggcgtg
gcctccctcttgaggcttcctcgaggctgtggggagcaaaccatgatctacttggctccg
acactggctgcttcccgctacctggacaagacagagcagtggagcacactgcctcccgag
accaaggaccacgccgtggatctgatccagaaaggctacatgcggatccagcagtttcgg
aaggcggatggttcctatgcggcttggttgtcacggggcagcagcacctggctcacagcc
tttgtgttgaaggtcctgagtttggcccaggagcaggtaggaggctcgcctgagaaactg
caggagacatctaactggcttctgtcccagcagcaggctgacggctcgttccaggacctc
tctccagtgatacataggagcatgcaggggggtttggtgggcaatgatgagactgtggca
ctcacagcctttgtgaccatcgcccttcatcatgggctggccgtcttccaggatgagggt
gcagagccattgaagcagagagtggaagcctccatctcaaaggcaagctcatttttgggg
gagaaagcaagtgctgggctcctgggtgcccacgcagctgccatcacggcctatgccctg
acactgaccaaggcccctgcggacctgcggggtgttgcccacaacaacctcatggcaatg
gcccaggagactggagataacctgtactggggctcagtcactggttctcagagcaatgcc
gtgtcgcccaccccggctcctcgcaacccatccgaccccatgccccaggccccagccctg
tggattgaaaccacagcctacgccctgctgcacctcctgcttcacgagggcaaagcagag
atggcagaccaggctgcggcctggctcacccgtcagggcagcttccaagggggattccgc
agtacccaagacacggtgattgccctggatgccctgtctgcctactggattgcctcccac
accactgaggagaggggtctcaatgtgactctcagctccacaggccggaatgggttcaag
tcccacgcgctgcagctgaacaaccgccagattcgcggcctggaggaggagctgcagttt
tccttgggcagcaagatcaatgtgaaggtgggaggaaacagcaaaggaaccctgaaggtc
cttcgtacctacaatgtcctggacatgaagaacacgacctgccaggacctacagatagaa
gtgacagtcaaaggccacgtcgagtacacgatggaagcaaacgaggactatgaggactat
gagtacgatgagcttccagccaaggatgacccagatgcccctctgcagcccgtgacaccc
ctgcagctgtttgagggtcggaggaaccgccgcaggagggaggcgcccaaggtggtggag
gagcaggagtccagggtgcactacaccgtgtgcatctggcggaacggcaaggtggggctg
tctggcatggccatcgcggacgtcaccctcctgagtggattccacgccctgcgtgctgac
ctggagaagctgacctccctctctgaccgttacgtgagtcactttgagaccgaggggccc
cacgtcctgctgtattttgactcggtccccacctcccgggagtgcgtgggctttgaggct
gtgcaggaagtgccggtggggctggtgcagccggccagcgcaaccctgtacgactactac
aaccccgagcgcagatgttctgtgttttacggggcaccaagtaagagcagactcttggcc
accttgtgttctgctgaagtctgccagtgtgctgaggggaagtgccctcgccagcgtcgc
gccctggagcggggtctgcaggacgaggatggctacaggatgaagtttgcctgctactac
ccccgtgtggagtacggcttccaggttaaggttctccgagaagacagcagagctgctttc
cgcctctttgagaccaagatcacccaagtcctgcacttcaccaaggatgtcaaggccgct
gctaatcagatgcgcaacttcctggttcgagcctcctgccgccttcgcttggaacctggg
aaagaatatttgatcatgggtctggatggggccacctatgacctcgagggacacccccag
tacctgctggactcgaatagctggatcgaggagatgccctctgaacgcctgtgccggagc
acccgccagcgggcagcctgtgcccagctcaacgacttcctccaggagtatggcactcag
gggtgccaggtgtga

DBGET integrated database retrieval system