KEGG   Homo sapiens (human): 7251
Entry
7251              CDS       T01001                                 
Symbol
TSG101, TSG10, VPS23
Name
(RefSeq) tumor susceptibility 101
  KO
K12183  ESCRT-I complex subunit TSG101
Organism
hsa  Homo sapiens (human)
Pathway
hsa03250  Viral life cycle - HIV-1
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    7251 (TSG101)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    7251 (TSG101)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7251 (TSG101)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7251 (TSG101)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-I complex
    7251 (TSG101)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   7251 (TSG101)
SSDB
Motif
Pfam: UEV Vps23_core DUF3450 MIC19_MIC25 UQ_con Macoilin FapA GPS2_interact CCDC90-like DUF5685 Exonuc_VII_L Prominin Spc7 SlyX APG6_N Fzo_mitofusin Nsp1_C TMPIT DUF1664 RNase_Y_N
Other DBs
NCBI-GeneID: 7251
NCBI-ProteinID: NP_006283
OMIM: 601387
HGNC: 15971
Ensembl: ENSG00000074319
Pharos: Q99816(Tbio)
UniProt: Q99816
Structure
LinkDB
Position
11:complement(18480311..18526942)
AA seq 390 aa
MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIP
VPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHP
QSDLLGLIQVMIVVFGDEPPVFSRPISASYPPYQATGPPNTSYMPGMPGGISPYPSGYPP
NPSGYPGCPYPPGGPYPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRW
RMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSS
ALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFL
KHVRLLSRKQFQLRALMQKARKTAGLSDLY
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggcggtgtcggagagccagctcaagaaaatggtgtccaagtacaaatacagagaccta
actgtacgtgaaactgtcaatgttattactctatacaaagatctcaaacctgttttggat
tcatatgtttttaacgatggcagttccagggaactaatgaacctcactggaacaatccct
gtgccttatagaggtaatacatacaatattccaatatgcctatggctactggacacatac
ccatataatccccctatctgttttgttaagcctactagttcaatgactattaaaacagga
aagcatgttgatgcaaatgggaagatatatcttccttatctacatgaatggaaacaccca
cagtcagacttgttggggcttattcaggtcatgattgtggtatttggagatgaacctcca
gtcttctctcgtcctatttcggcatcctatccgccataccaggcaacggggccaccaaat
acttcctacatgccaggcatgccaggtggaatctctccatacccatccggataccctccc
aatcccagtggttacccaggctgtccttacccacctggtggtccatatcctgccacaaca
agttctcagtacccttctcagcctcctgtgaccactgttggtcccagtagggatggcaca
atcagcgaggacaccatccgagcctctctcatctctgcggtcagtgacaaactgagatgg
cggatgaaggaggaaatggatcgtgcccaggcagagctcaatgccttgaaacgaacagaa
gaagacctgaaaaagggtcaccagaaactggaagagatggttacccgtttagatcaagaa
gtagccgaggttgataaaaacatagaacttttgaaaaagaaggatgaagaactcagttct
gctctggaaaaaatggaaaatcagtctgaaaacaatgatatcgatgaagttatcattccc
acagctcccttatacaaacagatcctgaatctgtatgcagaagaaaacgctattgaagac
actatcttttacttgggagaagccttgagaaggggcgtgatagacctggatgtcttcctg
aagcatgtacgtcttctgtcccgtaaacagttccagctgagggcactaatgcaaaaagca
agaaagactgccggtctcagtgacctctactga

DBGET integrated database retrieval system