KEGG   Homo sapiens (human): 735
Entry
735               CDS       T01001                                 

Gene name
C9, ARMD15, C9D
Definition
(RefSeq) complement C9
  KO
K04000  complement component 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion disease
hsa05146  Amoebiasis
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N00463  Alternative pathway of complement activation
N01311  Lectin pathway of complement activation
N01312  SARS-CoV-2 S to lectin pathway of complement activation
N01313  Classical pathway of complement activation
N01314  SARS-CoV-2 S to classical pathway of complement activation
Disease
H00103  Late complement pathway defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    735 (C9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    735 (C9)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    735 (C9)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    735 (C9)
  09164 Neurodegenerative disease
   05020 Prion disease
    735 (C9)
SSDB
Motif
Pfam: MACPF Ldl_recept_a TSP1_spondin TSP_1 eIF-5_eIF-2B
Other DBs
NCBI-GeneID: 735
NCBI-ProteinID: NP_001728
OMIM: 120940
HGNC: 1358
Ensembl: ENSG00000113600
Vega: OTTHUMG00000094767
Pharos: P02748(Tbio)
UniProt: P02748
LinkDB
Structure
PDB: 
6DLW 6H04 5FMW

Position
5p13.1
AA seq 559 aa
MSACRSFAVAICILEISILTAQYTTSYDPELTESSGSASHIDCRMSPWSEWSQCDPCLRQ
MFRSRSIEVFGQFNGKRCTDAVGDRRQCVPTEPCEDAEDDCGNDFQCSTGRCIKMRLRCN
GDNDCGDFSDEDDCESEPRPPCRDRVVEESELARTAGYGINILGMDPLSTPFDNEFYNGL
CNRDRDGNTLTYYRRPWNVASLIYETKGEKNFRTEHYEEQIEAFKSIIQEKTSNFNAAIS
LKFTPTETNKAEQCCEETASSISLHGKGSFRFSYSKNETYQLFLSYSSKKEKMFLHVKGE
IHLGRFVMRNRDVVLTTTFVDDIKALPTTYEKGEYFAFLETYGTHYSSSGSLGGLYELIY
VLDKASMKRKGVELKDIKRCLGYHLDVSLAFSEISVGAEFNKDDCVKRGEGRAVNITSEN
LIDDVVSLIRGGTRKYAFELKEKLLRGTVIDVTDFVNWASSINDAPVLISQKLSPIYNLV
PVKMKNAHLKKQNLERAIEDYINEFSVRKCHTCQNGGTVILMDGKCLCACPFKFEGIACE
ISKQKISEGLPALEFPNEK
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgtcagcctgccggagctttgcagttgcaatctgcattttagaaataagcatcctcaca
gcacagtacacgaccagttatgacccagagctaacagaaagcagtggctctgcatcacac
atagactgcagaatgagcccctggagtgaatggtcacaatgcgatccttgtctcagacaa
atgtttcgttcaagaagcattgaggtctttggacaatttaatgggaaaagatgcaccgac
gctgtgggagacagacgacagtgtgtgcccacagagccctgtgaggatgctgaggatgac
tgcggaaatgactttcaatgcagtacaggcagatgcataaagatgcgacttcggtgtaat
ggtgacaatgactgcggagacttttcagatgaggatgattgtgaaagtgagccccgtccc
ccctgcagagacagagtggtagaagagtctgagctggcacgaacagcaggctatgggatc
aacattttagggatggatcccctaagcacaccttttgacaatgagttctacaatggactc
tgtaaccgggatcgggatggaaacactctgacatactaccgaagaccttggaacgtggct
tctttgatctatgaaaccaaaggcgagaaaaatttcagaaccgaacattacgaagaacaa
attgaagcatttaaaagtatcatccaagagaagacatcaaattttaatgcagctatatct
ctaaaatttacacccactgaaacaaataaagctgaacaatgttgtgaggaaacagcctcc
tcaatttctttacatggcaagggtagttttcggttttcatattccaaaaatgaaacttac
caactatttttgtcatattcttcaaagaaggaaaaaatgtttctgcatgtgaaaggagaa
attcatctgggaagatttgtaatgagaaatcgcgatgttgtgctcacaacaacttttgtg
gatgatataaaagctttgccaactacctatgaaaagggagaatattttgcctttttggaa
acctatggaactcactacagtagctctgggtctctaggaggactctatgaactaatatat
gttttggataaagcttccatgaagcggaaaggtgttgaactaaaagacataaagagatgc
cttgggtatcatctggatgtatctctggctttctctgaaatctctgttggagctgaattt
aataaagatgattgtgtaaagaggggagagggtagagctgtaaacatcaccagtgaaaac
ctcatagatgatgttgtttcactcataagaggtggaaccagaaaatatgcatttgaactg
aaagaaaagcttctccgaggaaccgtgattgatgtgactgactttgtcaactgggcctct
tccataaatgatgctcctgttctcattagtcaaaaactgtctcctatatataatctggtt
ccagtgaaaatgaaaaatgcacacctaaagaaacaaaacttggaaagagccattgaagac
tatatcaatgaatttagtgtaagaaaatgccacacatgccaaaatggaggtacagtgatt
ctaatggatggaaagtgtttgtgtgcctgcccattcaaatttgagggaattgcctgtgaa
atcagtaaacaaaaaatttctgaaggattgccagccctagagttccccaatgaaaaatag

DBGET integrated database retrieval system