KEGG   Homo sapiens (human): 735
Entry
735               CDS       T01001                                 
Symbol
C9, ARMD15, C9D
Name
(RefSeq) complement C9
  KO
K04000  complement component 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa04810  Regulation of actin cytoskeleton
hsa05020  Prion disease
hsa05146  Amoebiasis
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06513  Complement cascade
  Element
N01490  Common pathway of complement cascade, MAC formation
N01505  Regulation of complement cascade, MAC inhibition
Disease
H00103  Late complement pathway defects
H00821  Age-related macular degeneration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    735 (C9)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    735 (C9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    735 (C9)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    735 (C9)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    735 (C9)
  09164 Neurodegenerative disease
   05020 Prion disease
    735 (C9)
SSDB
Motif
Pfam: MACPF Ldl_recept_a TSP1_spondin TSP_1 eIF-5_eIF-2B
Other DBs
NCBI-GeneID: 735
NCBI-ProteinID: NP_001728
OMIM: 120940
HGNC: 1358
Ensembl: ENSG00000113600
Pharos: P02748(Tbio)
UniProt: P02748
Structure
LinkDB
Position
5:complement(39284140..39364495)
AA seq 559 aa
MSACRSFAVAICILEISILTAQYTTSYDPELTESSGSASHIDCRMSPWSEWSQCDPCLRQ
MFRSRSIEVFGQFNGKRCTDAVGDRRQCVPTEPCEDAEDDCGNDFQCSTGRCIKMRLRCN
GDNDCGDFSDEDDCESEPRPPCRDRVVEESELARTAGYGINILGMDPLSTPFDNEFYNGL
CNRDRDGNTLTYYRRPWNVASLIYETKGEKNFRTEHYEEQIEAFKSIIQEKTSNFNAAIS
LKFTPTETNKAEQCCEETASSISLHGKGSFRFSYSKNETYQLFLSYSSKKEKMFLHVKGE
IHLGRFVMRNRDVVLTTTFVDDIKALPTTYEKGEYFAFLETYGTHYSSSGSLGGLYELIY
VLDKASMKRKGVELKDIKRCLGYHLDVSLAFSEISVGAEFNKDDCVKRGEGRAVNITSEN
LIDDVVSLIRGGTRKYAFELKEKLLRGTVIDVTDFVNWASSINDAPVLISQKLSPIYNLV
PVKMKNAHLKKQNLERAIEDYINEFSVRKCHTCQNGGTVILMDGKCLCACPFKFEGIACE
ISKQKISEGLPALEFPNEK
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgtcagcctgccggagctttgcagttgcaatctgcattttagaaataagcatcctcaca
gcacagtacacgaccagttatgacccagagctaacagaaagcagtggctctgcatcacac
atagactgcagaatgagcccctggagtgaatggtcacaatgcgatccttgtctcagacaa
atgtttcgttcaagaagcattgaggtctttggacaatttaatgggaaaagatgcaccgac
gctgtgggagacagacgacagtgtgtgcccacagagccctgtgaggatgctgaggatgac
tgcggaaatgactttcaatgcagtacaggcagatgcataaagatgcgacttcggtgtaat
ggtgacaatgactgcggagacttttcagatgaggatgattgtgaaagtgagccccgtccc
ccctgcagagacagagtggtagaagagtctgagctggcacgaacagcaggctatgggatc
aacattttagggatggatcccctaagcacaccttttgacaatgagttctacaatggactc
tgtaaccgggatcgggatggaaacactctgacatactaccgaagaccttggaacgtggct
tctttgatctatgaaaccaaaggcgagaaaaatttcagaaccgaacattacgaagaacaa
attgaagcatttaaaagtatcatccaagagaagacatcaaattttaatgcagctatatct
ctaaaatttacacccactgaaacaaataaagctgaacaatgttgtgaggaaacagcctcc
tcaatttctttacatggcaagggtagttttcggttttcatattccaaaaatgaaacttac
caactatttttgtcatattcttcaaagaaggaaaaaatgtttctgcatgtgaaaggagaa
attcatctgggaagatttgtaatgagaaatcgcgatgttgtgctcacaacaacttttgtg
gatgatataaaagctttgccaactacctatgaaaagggagaatattttgcctttttggaa
acctatggaactcactacagtagctctgggtctctaggaggactctatgaactaatatat
gttttggataaagcttccatgaagcggaaaggtgttgaactaaaagacataaagagatgc
cttgggtatcatctggatgtatctctggctttctctgaaatctctgttggagctgaattt
aataaagatgattgtgtaaagaggggagagggtagagctgtaaacatcaccagtgaaaac
ctcatagatgatgttgtttcactcataagaggtggaaccagaaaatatgcatttgaactg
aaagaaaagcttctccgaggaaccgtgattgatgtgactgactttgtcaactgggcctct
tccataaatgatgctcctgttctcattagtcaaaaactgtctcctatatataatctggtt
ccagtgaaaatgaaaaatgcacacctaaagaaacaaaacttggaaagagccattgaagac
tatatcaatgaatttagtgtaagaaaatgccacacatgccaaaatggaggtacagtgatt
ctaatggatggaaagtgtttgtgtgcctgcccattcaaatttgagggaattgcctgtgaa
atcagtaaacaaaaaatttctgaaggattgccagccctagagttccccaatgaaaaatag

DBGET integrated database retrieval system