KEGG   Homo sapiens (human): 7456
Entry
7456              CDS       T01001                                 

Symbol
WIPF1, PRPL-2, WAS2, WASPIP, WIP
Name
(RefSeq) WAS/WASL interacting protein family member 1
  KO
K19475  WAS/WASL-interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa05130  Pathogenic Escherichia coli infection
hsa05135  Yersinia infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01078  EGF-EGFR-Actin signaling pathway
N01092  Escherichia Eae/Tir to Actin signaling pathway
Disease
H01523  Wiskott-Aldrich syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    7456 (WIPF1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    7456 (WIPF1)
   05135 Yersinia infection
    7456 (WIPF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7456 (WIPF1)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    7456 (WIPF1)
SSDB
Motif
Pfam: WH2 GRP
Other DBs
NCBI-GeneID: 7456
NCBI-ProteinID: NP_001070737
OMIM: 602357
HGNC: 12736
Ensembl: ENSG00000115935
Vega: OTTHUMG00000132334
Pharos: O43516(Tbio)
UniProt: O43516 Q2YDC4 A0A140VJZ9
Structure
LinkDB
Position
2:complement(174559574..174682913)
AA seq 503 aa
MPVPPPPAPPPPPTFALANTEKPTLNKTEQAGRNALLSDISKGKKLKKTVTNDRSAPILD
KPKGAGAGGGGGGFGGGGGFGGGGGGGGGGSFGGGGPPGLGGLFQAGMPKLRSTANRDND
SGGSRPPLLPPGGRSTSAKPFSPPSGPGRFPVPSPGHRSGPPEPQRNRMPPPRPDVGSKP
DSIPPPVPSTPRPIQSSPHNRGSPPVPGGPRQPSPGPTPPPFPGNRGTALGGGSIRQSPL
SSSSPFSNRPPLPPTPSRALDDKPPPPPPPVGNRPSIHREAVPPPPPQNNKPPVPSTPRP
SASSQAPPPPPPPSRPGPPPLPPSSSGNDETPRLPQRNLSLSSSTPPLPSPGRSGPLPPP
PSERPPPPVRDPPGRSGPLPPPPPVSRNGSTSRALPATPQLPSRSGVDSPRSGPRPPLPP
DRPSAGAPPPPPPSTSIRNGFQDSPCEDEWESRFYFHPISDLPPPEPYVQTTKSYPSKLA
RNESRSGSNRRERGAPPLPPIPR
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgcctgtccctccccctccagcacccccgccgcccccgacgtttgcactggccaataca
gagaagcctaccttgaataagacagagcaggctgggagaaatgctctcctttctgatatc
agcaaagggaagaaactaaagaagacggtcaccaatgacagaagtgcaccaatactggac
aaacctaaaggagctggtgctggaggcggtggtggtggctttggtggaggcggcggattt
ggcggaggaggtggtggcggaggcggtggaagttttggagggggcggacctccaggtctg
ggaggattgttccaggctggaatgccgaagctgagatccacggccaacagggataatgat
tctggaggaagccgaccaccattgttgccaccgggaggaagatccacatctgcgaaaccc
ttttcacccccaagtggcccagggaggtttcctgtgccttctccaggccacagaagtggt
cccccagagcctcagaggaaccgaatgccgcccccaaggcccgacgtgggctcaaagcct
gatagcattcctcctccagtacctagtactccaagacccattcaatcaagtccgcacaac
cgggggtccccaccagtgcccggaggccccaggcagcccagccccgggcccactcctccc
cctttccctggaaaccgcggcactgctttgggaggaggctcaatacgtcagtcccccttg
agctcctcctcgcccttctccaaccggcctcccctgccgcctacccccagcagggccttg
gatgacaaaccccctccaccacctcctccagtgggcaacaggccctccatccacagggaa
gcggttccccctcctcctcctcagaacaacaagcctccagtgccttccactccgcggcct
tcggcctcctcacaggccccacctccgccgccacctcccagcaggcccgggccgcctcct
ctgcctccaagttccagcggcaatgacgaaaccccaagactcccacagcggaatctgtcc
ctcagttcgtccacgcccccgttaccttcgccaggacgttcaggtcctcttcctcccccg
cccagtgagagacccccacctccagtgagggacccgccaggccgatcaggccccctccca
ccacctcctccagtaagcagaaacggcagcacatctcgggccctgcctgctacccctcag
ttgccatccaggagtggagtagacagtcccaggagtggacccaggcctccccttcctcct
gataggcccagtgctggggcacctcccccacctccaccatcaacatctattagaaatggc
ttccaagactctccatgtgaagatgagtgggaaagcagattctacttccatccgatttcc
gatttgccacctccagagccatatgtacaaacgaccaaaagttatcccagcaaactggca
agaaacgaaagccggagtggatccaaccgaagagaaaggggtgctccaccactccctccc
atcccgaggtga

DBGET integrated database retrieval system