KEGG   Homo sapiens (human): 7471
Entry
7471              CDS       T01001                                 
Symbol
WNT1, BMND16, INT1, OI15
Name
(RefSeq) Wnt family member 1
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06227  Nuclear receptor signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
nt06505  WNT signaling
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N01363  P4/MPA to nuclear-initiated progesterone signaling pathway
N01442  Wnt signaling modulation, Wnt inhibitor
N01443  Wnt signaling modulation, Wnt acylation
Disease
H00506  Osteogenesis imperfecta
H01593  Osteoporosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7471 (WNT1)
   04390 Hippo signaling pathway
    7471 (WNT1)
   04150 mTOR signaling pathway
    7471 (WNT1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7471 (WNT1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7471 (WNT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7471 (WNT1)
   05205 Proteoglycans in cancer
    7471 (WNT1)
   05207 Chemical carcinogenesis - receptor activation
    7471 (WNT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7471 (WNT1)
   05226 Gastric cancer
    7471 (WNT1)
   05217 Basal cell carcinoma
    7471 (WNT1)
   05224 Breast cancer
    7471 (WNT1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7471 (WNT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    7471 (WNT1)
   05022 Pathways of neurodegeneration - multiple diseases
    7471 (WNT1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7471 (WNT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7471 (WNT1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Morphogens
   7471 (WNT1)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 7471
NCBI-ProteinID: NP_005421
OMIM: 164820
HGNC: 12774
Ensembl: ENSG00000125084
Pharos: P04628(Tbio)
UniProt: P04628
LinkDB
Position
12:48978322..48982620
AA seq 370 aa
MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggggctctgggcgctgttgcctggctgggtttctgctacgctgctgctggcgctggcc
gctctgcccgcagccctggctgccaacagcagtggccgatggtggggtattgtgaacgta
gcctcctccacgaacctgcttacagactccaagagtctgcaactggtactcgagcccagt
ctgcagctgttgagccgcaaacagcggcgtctgatacgccaaaatccggggatcctgcac
agcgtgagtggggggctgcagagtgccgtgcgcgagtgcaagtggcagttccggaatcgc
cgctggaactgtcccactgctccagggccccacctcttcggcaagatcgtcaaccgaggc
tgtcgagaaacggcgtttatcttcgctatcacctccgccggggtcacccattcggtggcg
cgctcctgctcagaaggttccatcgaatcctgcacgtgtgactaccggcggcgcggcccc
gggggccccgactggcactgggggggctgcagcgacaacattgacttcggccgcctcttc
ggccgggagttcgtggactccggggagaaggggcgggacctgcgcttcctcatgaacctt
cacaacaacgaggcaggccgtacgaccgtattctccgagatgcgccaggagtgcaagtgc
cacgggatgtccggctcatgcacggtgcgcacgtgctggatgcggctgcccacgctgcgc
gccgtgggcgatgtgctgcgcgaccgcttcgacggcgcctcgcgcgtcctgtacggcaac
cgcggcagcaaccgcgcttcgcgggcggagctgctgcgcctggagccggaagacccggcc
cacaaaccgccctccccccacgacctcgtctacttcgagaaatcgcccaacttctgcacg
tacagcggacgcctgggcacagcaggcacggcagggcgcgcctgtaacagctcgtcgccc
gcgctggacggctgcgagctgctctgctgcggcaggggccaccgcacgcgcacgcagcgc
gtcaccgagcgctgcaactgcaccttccactggtgctgccacgtcagctgccgcaactgc
acgcacacgcgcgtactgcacgagtgtctgtga

KEGG   Homo sapiens (human): 7472
Entry
7472              CDS       T01001                                 
Symbol
WNT2, INT1L1, IRP
Name
(RefSeq) Wnt family member 2
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
nt06505  WNT signaling
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N01442  Wnt signaling modulation, Wnt inhibitor
N01443  Wnt signaling modulation, Wnt acylation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7472 (WNT2)
   04390 Hippo signaling pathway
    7472 (WNT2)
   04150 mTOR signaling pathway
    7472 (WNT2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7472 (WNT2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7472 (WNT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7472 (WNT2)
   05205 Proteoglycans in cancer
    7472 (WNT2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7472 (WNT2)
   05226 Gastric cancer
    7472 (WNT2)
   05217 Basal cell carcinoma
    7472 (WNT2)
   05224 Breast cancer
    7472 (WNT2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7472 (WNT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    7472 (WNT2)
   05022 Pathways of neurodegeneration - multiple diseases
    7472 (WNT2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7472 (WNT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7472 (WNT2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Morphogens
   7472 (WNT2)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 7472
NCBI-ProteinID: NP_003382
OMIM: 147870
HGNC: 12780
Ensembl: ENSG00000105989
Pharos: P09544(Tbio)
UniProt: P09544 A0A384MDX3
LinkDB
Position
7:complement(117275451..117323058)
AA seq 360 aa
MNAPLGGIWLWLPLLLTWLTPEVNSSWWYMRATGGSSRVMCDNVPGLVSSQRQLCHRHPD
VMRAISQGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVV
FAITRACSQGEVKSCSCDPKKMGSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSHVTRMTKCGCKFHWCCAVRCQDCLEALDVHTCKAPKNADWTTAT
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaacgcccctctcggtggaatctggctctggctccctctgctcttgacctggctcacc
cccgaggtcaactcttcatggtggtacatgagagctacaggtggctcctccagggtgatg
tgcgataatgtgccaggcctggtgagcagccagcggcagctgtgtcaccgacatccagat
gtgatgcgtgccattagccagggcgtggccgagtggacagcagaatgccagcaccagttc
cgccagcaccgctggaattgcaacaccctggacagggatcacagcctttttggcagggtc
ctactccgaagtagtcgggaatctgcctttgtttatgccatctcctcagctggagttgta
tttgccatcaccagggcctgtagccaaggagaagtaaaatcctgttcctgtgatccaaag
aagatgggaagcgccaaggacagcaaaggcatttttgattggggtggctgcagtgataac
attgactatgggatcaaatttgcccgcgcatttgtggatgcaaaggaaaggaaaggaaag
gatgccagagccctgatgaatcttcacaacaacagagctggcaggaaggctgtaaagcgg
ttcttgaaacaagagtgcaagtgccacggggtgagcggctcatgtactctcaggacatgc
tggctggccatggccgacttcaggaaaacgggcgattatctctggaggaagtacaatggg
gccatccaggtggtcatgaaccaggatggcacaggtttcactgtggctaacgagaggttt
aagaagccaacgaaaaatgacctcgtgtattttgagaattctccagactactgtatcagg
gaccgagaggcaggctccctgggtacagcaggccgtgtgtgcaacctgacttcccggggc
atggacagctgtgaagtcatgtgctgtgggagaggctacgacacctcccatgtcacccgg
atgaccaagtgtgggtgtaagttccactggtgctgcgccgtgcgctgtcaggactgcctg
gaagctctggatgtgcacacatgcaaggcccccaagaacgctgactggacaaccgctaca
tga

KEGG   Homo sapiens (human): 7482
Entry
7482              CDS       T01001                                 
Symbol
WNT2B, WNT13
Name
(RefSeq) Wnt family member 2B
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
nt06505  WNT signaling
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N01442  Wnt signaling modulation, Wnt inhibitor
N01443  Wnt signaling modulation, Wnt acylation
Disease
H01174  Congenital diarrhea
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7482 (WNT2B)
   04390 Hippo signaling pathway
    7482 (WNT2B)
   04150 mTOR signaling pathway
    7482 (WNT2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7482 (WNT2B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7482 (WNT2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7482 (WNT2B)
   05205 Proteoglycans in cancer
    7482 (WNT2B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7482 (WNT2B)
   05226 Gastric cancer
    7482 (WNT2B)
   05217 Basal cell carcinoma
    7482 (WNT2B)
   05224 Breast cancer
    7482 (WNT2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7482 (WNT2B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    7482 (WNT2B)
   05022 Pathways of neurodegeneration - multiple diseases
    7482 (WNT2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7482 (WNT2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7482 (WNT2B)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Morphogens
   7482 (WNT2B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 7482
NCBI-ProteinID: NP_078613
OMIM: 601968
HGNC: 12781
Ensembl: ENSG00000134245
Pharos: Q93097(Tbio)
UniProt: Q93097
LinkDB
Position
1:112466541..112530165
AA seq 391 aa
MLRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLLTLPARVDTSW
WYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTT
LDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQR
GDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCH
GVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLV
YFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFH
WCCAVRCKECRNTVDVHTCKAPKKAEWLDQT
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgctgagaccgggtggtgcggaggaagctgcgcagctcccgcttcggcgcgccagcgcc
ccggtccctgtgccgtcgcccgcggcccccgacggctcccgggcttcggcccgcctaggt
cttgcctgccttctgctcctgctgctgctgacgctgccggcccgcgtagacacgtcctgg
tggtacattggggcactgggggcacgagtgatctgtgacaatatccctggtttggtgagc
cggcagcggcagctgtgccagcgttacccagacatcatgcgttcagtgggcgagggtgcc
cgagaatggatccgagagtgtcagcaccaattccgccaccaccgctggaactgtaccacc
ctggaccgggaccacaccgtctttggccgtgtcatgctcagaagtagccgagaggcagct
tttgtatatgccatctcatcagcaggggtagtccacgctattactcgcgcctgtagccag
ggtgaactgagtgtgtgcagctgtgacccctacacccgtggccgacaccatgaccagcgt
ggggactttgactggggtggctgcagtgacaacatccactacggtgtccgttttgccaag
gccttcgtggatgccaaggagaagaggcttaaggatgcccgggccctcatgaacttacat
aataaccgctgtggtcgcacggctgtgcggcggtttctgaagctggagtgtaagtgccat
ggcgtgagtggttcctgtactctgcgcacctgctggcgtgcactctcagatttccgccgc
acaggtgattacctgcggcgacgctatgatggggctgtgcaggtgatggccacccaagat
ggtgccaacttcaccgcagcccgccaaggctatcgccgtgccacccggactgatcttgtc
tactttgacaactctccagattactgtgtcttggacaaggctgcaggttccctaggcact
gcaggccgtgtctgcagcaagacatcaaaaggaacagacggttgtgaaatcatgtgctgt
ggccgagggtacgacacaactcgagtcacccgtgttacccagtgtgagtgcaaattccac
tggtgctgtgctgtacggtgcaaggaatgcagaaatactgtggacgtccatacttgcaaa
gcccccaagaaggcagagtggctggaccaaacctga

KEGG   Homo sapiens (human): 7473
Entry
7473              CDS       T01001                                 
Symbol
WNT3, INT4, TETAMS
Name
(RefSeq) Wnt family member 3
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
nt06505  WNT signaling
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N01442  Wnt signaling modulation, Wnt inhibitor
N01443  Wnt signaling modulation, Wnt acylation
Disease
H00636  Tetra-amelia syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7473 (WNT3)
   04390 Hippo signaling pathway
    7473 (WNT3)
   04150 mTOR signaling pathway
    7473 (WNT3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7473 (WNT3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7473 (WNT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7473 (WNT3)
   05206 MicroRNAs in cancer
    7473 (WNT3)
   05205 Proteoglycans in cancer
    7473 (WNT3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7473 (WNT3)
   05226 Gastric cancer
    7473 (WNT3)
   05217 Basal cell carcinoma
    7473 (WNT3)
   05224 Breast cancer
    7473 (WNT3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7473 (WNT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    7473 (WNT3)
   05022 Pathways of neurodegeneration - multiple diseases
    7473 (WNT3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7473 (WNT3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7473 (WNT3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Morphogens
   7473 (WNT3)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 7473
NCBI-ProteinID: NP_110380
OMIM: 165330
HGNC: 12782
Ensembl: ENSG00000108379
Pharos: P56703(Tchem)
UniProt: P56703
Structure
LinkDB
Position
17:complement(46762506..46818692)
AA seq 355 aa
MEPHLLGLLLGLLLGGTRVLAGYPIWWSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCR
NYIEIMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIAS
AGVAFAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRP
DARSAMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDS
ASEMVVEKHRESRGWVETLRAKYSLFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTC
NVTSHGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECIRIYDVHTCK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggagccccacctgctcgggctgctcctcggcctcctgctcggtggcaccagggtcctc
gctggctacccaatttggtggtccctggccctgggccagcagtacacatctctgggctca
cagcccctgctctgcggctccatcccaggcctggtccccaagcaactgcgcttctgccgc
aattacatcgagatcatgcccagcgtggccgagggcgtgaagctgggcatccaggagtgc
cagcaccagttccggggccgccgctggaactgcaccaccatagatgacagcctggccatc
tttgggcccgtcctcgacaaagccacccgcgagtcggccttcgttcacgccatcgcctcg
gccggcgtggccttcgccgtcacccgctcctgcgccgagggcacctccaccatttgcggc
tgtgactcgcatcataaggggccgcctggcgaaggctggaagtggggcggctgcagcgag
gacgctgacttcggcgtgttagtgtccagggagttcgcggatgcgcgcgagaacaggccg
gacgcgcgctcggccatgaacaagcacaacaacgaggcgggccgcacgactatcctggac
cacatgcacctcaaatgcaagtgccacgggctgtcgggcagctgtgaggtgaagacctgc
tggtgggcgcagcctgacttccgtgccatcggtgacttcctcaaggacaagtatgacagc
gcctcggagatggtagtagagaagcaccgtgagtcccgaggctgggtggagaccctccgg
gccaagtactcgctcttcaagccacccacggagagggacctggtctactacgagaactcc
cccaacttttgtgagcccaacccagagacgggttcctttggcacaagggaccggacttgc
aatgtcacctcccacggcatcgatggctgcgatctgctctgctgtggccggggccacaac
acgaggacggagaagcggaaggaaaaatgccactgcatcttccactggtgctgctacgtc
agctgccaggagtgtattcgcatctacgacgtgcacacctgcaagtag

KEGG   Homo sapiens (human): 89780
Entry
89780             CDS       T01001                                 
Symbol
WNT3A
Name
(RefSeq) Wnt family member 3A
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
nt06505  WNT signaling
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N01442  Wnt signaling modulation, Wnt inhibitor
N01443  Wnt signaling modulation, Wnt acylation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    89780 (WNT3A)
   04390 Hippo signaling pathway
    89780 (WNT3A)
   04150 mTOR signaling pathway
    89780 (WNT3A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    89780 (WNT3A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    89780 (WNT3A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    89780 (WNT3A)
   05206 MicroRNAs in cancer
    89780 (WNT3A)
   05205 Proteoglycans in cancer
    89780 (WNT3A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    89780 (WNT3A)
   05226 Gastric cancer
    89780 (WNT3A)
   05217 Basal cell carcinoma
    89780 (WNT3A)
   05224 Breast cancer
    89780 (WNT3A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    89780 (WNT3A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    89780 (WNT3A)
   05022 Pathways of neurodegeneration - multiple diseases
    89780 (WNT3A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    89780 (WNT3A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    89780 (WNT3A)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Morphogens
   89780 (WNT3A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 89780
NCBI-ProteinID: NP_149122
OMIM: 606359
HGNC: 15983
Ensembl: ENSG00000154342
Pharos: P56704(Tchem)
UniProt: P56704
Structure
LinkDB
Position
1:228006998..228061271
AA seq 352 aa
MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVPKQLRFCRNYV
EIMPSVAEGIKIGIQECQHQFRGRRWNCTTVHDSLAIFGPVLDKATRESAFVHAIASAGV
AFAVTRSCAEGTAAICGCSSRHQGSPGKGWKWGGCSEDIEFGGMVSREFADARENRPDAR
SAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRAIGDFLKDKYDSASE
MVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS
SHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHTCK
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggccccactcggatacttcttactcctctgcagcctgaagcaggctctgggcagctac
ccgatctggtggtcgctggctgttgggccacagtattcctccctgggctcgcagcccatc
ctgtgtgccagcatcccgggcctggtccccaagcagctccgcttctgcaggaactacgtg
gagatcatgcccagcgtggccgagggcatcaagattggcatccaggagtgccagcaccag
ttccgcggccgccggtggaactgcaccaccgtccacgacagcctggccatcttcgggccc
gtgctggacaaagctaccagggagtcggcctttgtccacgccattgcctcagccggtgtg
gcctttgcagtgacacgctcatgtgcagaaggcacggccgccatctgtggctgcagcagc
cgccaccagggctcaccaggcaagggctggaagtggggtggctgtagcgaggacatcgag
tttggtgggatggtgtctcgggagttcgccgacgcccgggagaaccggccagatgcccgc
tcagccatgaaccgccacaacaacgaggctgggcgccaggccatcgccagccacatgcac
ctcaagtgcaagtgccacgggctgtcgggcagctgcgaggtgaagacatgctggtggtcg
caacccgacttccgcgccatcggtgacttcctcaaggacaagtacgacagcgcctcggag
atggtggtggagaagcaccgggagtcccgcggctgggtggagaccctgcggccgcgctac
acctacttcaaggtgcccacggagcgcgacctggtctactacgaggcctcgcccaacttc
tgcgagcccaaccctgagacgggctccttcggcacgcgcgaccgcacctgcaacgtcagc
tcgcacggcatcgacggctgcgacctgctgtgctgcggccgcggccacaacgcgcgagcg
gagcggcgccgggagaagtgccgctgcgtgttccactggtgctgctacgtcagctgccag
gagtgcacgcgcgtctacgacgtgcacacctgcaagtag

KEGG   Homo sapiens (human): 54361
Entry
54361             CDS       T01001                                 
Symbol
WNT4, SERKAL, WNT-4
Name
(RefSeq) Wnt family member 4
  KO
K00408  wingless-type MMTV integration site family, member 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04919  Thyroid hormone signaling pathway
hsa04934  Cushing syndrome
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06227  Nuclear receptor signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
nt06505  WNT signaling
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N01362  Nuclear-initiated progesterone signaling pathway
N01442  Wnt signaling modulation, Wnt inhibitor
N01443  Wnt signaling modulation, Wnt acylation
Disease
H00600  Mullerian agenesis
H02317  SERKAL syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    54361 (WNT4)
   04390 Hippo signaling pathway
    54361 (WNT4)
   04150 mTOR signaling pathway
    54361 (WNT4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    54361 (WNT4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    54361 (WNT4)
   04916 Melanogenesis
    54361 (WNT4)
  09158 Development and regeneration
   04360 Axon guidance
    54361 (WNT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    54361 (WNT4)
   05205 Proteoglycans in cancer
    54361 (WNT4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    54361 (WNT4)
   05226 Gastric cancer
    54361 (WNT4)
   05217 Basal cell carcinoma
    54361 (WNT4)
   05224 Breast cancer
    54361 (WNT4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    54361 (WNT4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    54361 (WNT4)
   05022 Pathways of neurodegeneration - multiple diseases
    54361 (WNT4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    54361 (WNT4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    54361 (WNT4)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Morphogens
   54361 (WNT4)
SSDB
Motif
Pfam: wnt MEF2_binding
Other DBs
NCBI-GeneID: 54361
NCBI-ProteinID: NP_110388
OMIM: 603490
HGNC: 12783
Ensembl: ENSG00000162552
Pharos: P56705(Tbio)
UniProt: P56705
LinkDB
Position
1:complement(22117313..22143097)
AA seq 351 aa
MSPRSCLRSLRLLVFAVFSAAASNWLYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRN
LEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGV
AFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGAS
SSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDG
ATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGTRGRTCNKTS
KAIDGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRLVELHTCR
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgagtccccgctcgtgcctgcgttcgctgcgcctcctcgtcttcgccgtcttctcagcc
gccgcgagcaactggctgtacctggccaagctgtcgtcggtggggagcatctcagaggag
gagacgtgcgagaaactcaagggcctgatccagaggcaggtgcagatgtgcaagcggaac
ctggaagtcatggactcggtgcgccgcggtgcccagctggccattgaggagtgccagtac
cagttccggaaccggcgctggaactgctccacactcgactccttgcccgtcttcggcaag
gtggtgacgcaagggactcgggaggcggccttcgtgtacgccatctcttcggcaggtgtg
gcctttgcagtgacgcgggcgtgcagcagtggggagctggagaagtgcggctgtgacagg
acagtgcatggggtcagcccacagggcttccagtggtcaggatgctctgacaacatcgcc
tacggtgtggccttctcacagtcgtttgtggatgtgcgggagagaagcaagggggcctcg
tccagcagagccctcatgaacctccacaacaatgaggccggcaggaaggccatcctgaca
cacatgcgggtggaatgcaagtgccacggggtgtcaggctcctgtgaggtaaagacgtgc
tggcgagccgtgccgcccttccgccaggtgggtcacgcactgaaggagaagtttgatggt
gccactgaggtggagccacgccgcgtgggctcctccagggcactggtgccacgcaacgca
cagttcaagccgcacacagatgaggacctggtgtacttggagcctagccccgacttctgt
gagcaggacatgcgcagcggcgtgctgggcacgaggggccgcacatgcaacaagacgtcc
aaggccatcgacggctgtgagctgctgtgctgtggccgcggcttccacacggcgcaggtg
gagctggctgaacgctgcagctgcaaattccactggtgctgcttcgtcaagtgccggcag
tgccagcggctcgtggagttgcacacgtgccgatga

KEGG   Homo sapiens (human): 7474
Entry
7474              CDS       T01001                                 
Symbol
WNT5A, hWNT5A
Name
(RefSeq) Wnt family member 5A
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
nt06505  WNT signaling
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N01427  WNT5A-ROR signaling pathway
N01442  Wnt signaling modulation, Wnt inhibitor
N01443  Wnt signaling modulation, Wnt acylation
Disease
H00485  Robinow syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7474 (WNT5A)
   04390 Hippo signaling pathway
    7474 (WNT5A)
   04150 mTOR signaling pathway
    7474 (WNT5A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7474 (WNT5A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7474 (WNT5A)
  09158 Development and regeneration
   04360 Axon guidance
    7474 (WNT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7474 (WNT5A)
   05205 Proteoglycans in cancer
    7474 (WNT5A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7474 (WNT5A)
   05226 Gastric cancer
    7474 (WNT5A)
   05217 Basal cell carcinoma
    7474 (WNT5A)
   05224 Breast cancer
    7474 (WNT5A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7474 (WNT5A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    7474 (WNT5A)
   05022 Pathways of neurodegeneration - multiple diseases
    7474 (WNT5A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7474 (WNT5A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7474 (WNT5A)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Morphogens
   7474 (WNT5A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 7474
NCBI-ProteinID: NP_003383
OMIM: 164975
HGNC: 12784
Ensembl: ENSG00000114251
Pharos: P41221(Tbio)
UniProt: P41221 A0A384N611 B3KQX9
LinkDB
Position
3:complement(55465715..55505263)
AA seq 380 aa
MKKSIGILSPGVALGMAGSAMSSKFFLVALAIFFSFAQVVIEANSWWSLGMNNPVQMSEV
YIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDN
TSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWG
GCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKC
HGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
YIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH
WCCYVKCKKCTEIVDQFVCK
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgaagaagtccattggaatattaagcccaggagttgctttggggatggctggaagtgca
atgtcttccaagttcttcctagtggctttggccatatttttctccttcgcccaggttgta
attgaagccaattcttggtggtcgctaggtatgaataaccctgttcagatgtcagaagta
tatattataggagcacagcctctctgcagccaactggcaggactttctcaaggacagaag
aaactgtgccacttgtatcaggaccacatgcagtacatcggagaaggcgcgaagacaggc
atcaaagaatgccagtatcaattccgacatcgaaggtggaactgcagcactgtggataac
acctctgtttttggcagggtgatgcagataggcagccgcgagacggccttcacatacgcg
gtgagcgcagcaggggtggtgaacgccatgagccgggcgtgccgcgagggcgagctgtcc
acctgcggctgcagccgcgccgcgcgccccaaggacctgccgcgggactggctctggggc
ggctgcggcgacaacatcgactatggctaccgctttgccaaggagttcgtggacgcccgc
gagcgggagcgcatccacgccaagggctcctacgagagtgctcgcatcctcatgaacctg
cacaacaacgaggccggccgcaggacggtgtacaacctggctgatgtggcctgcaagtgc
catggggtgtccggctcatgtagcctgaagacatgctggctgcagctggcagacttccgc
aaggtgggtgatgccctgaaggagaagtacgacagcgcggcggccatgcggctcaacagc
cggggcaagttggtacaggtcaacagccgcttcaactcgcccaccacacaagacctggtc
tacatcgaccccagccctgactactgcgtgcgcaatgagagcaccggctcgctgggcacg
cagggccgcctgtgcaacaagacgtcggagggcatggatggctgcgagctcatgtgctgc
ggccgtggctacgaccagttcaagaccgtgcagacggagcgctgccactgcaagttccac
tggtgctgctacgtcaagtgcaagaagtgcacggagatcgtggaccagtttgtgtgcaag
tag

KEGG   Homo sapiens (human): 81029
Entry
81029             CDS       T01001                                 
Symbol
WNT5B
Name
(RefSeq) Wnt family member 5B
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
nt06505  WNT signaling
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N01442  Wnt signaling modulation, Wnt inhibitor
N01443  Wnt signaling modulation, Wnt acylation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    81029 (WNT5B)
   04390 Hippo signaling pathway
    81029 (WNT5B)
   04150 mTOR signaling pathway
    81029 (WNT5B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    81029 (WNT5B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    81029 (WNT5B)
  09158 Development and regeneration
   04360 Axon guidance
    81029 (WNT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    81029 (WNT5B)
   05205 Proteoglycans in cancer
    81029 (WNT5B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    81029 (WNT5B)
   05226 Gastric cancer
    81029 (WNT5B)
   05217 Basal cell carcinoma
    81029 (WNT5B)
   05224 Breast cancer
    81029 (WNT5B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    81029 (WNT5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    81029 (WNT5B)
   05022 Pathways of neurodegeneration - multiple diseases
    81029 (WNT5B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    81029 (WNT5B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    81029 (WNT5B)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Morphogens
   81029 (WNT5B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 81029
NCBI-ProteinID: NP_110402
OMIM: 606361
HGNC: 16265
Ensembl: ENSG00000111186
Pharos: Q9H1J7(Tbio)
UniProt: Q9H1J7
LinkDB
Position
12:1617056..1647212
AA seq 359 aa
MPSLLLLFTAALLSSWAQLLTDANSWWSLALNPVQRPEMFIIGAQPVCSQLPGLSPGQRK
LCQLYQEHMAYIGEGAKTGIKECQHQFRQRRWNCSTADNASVFGRVMQIGSRETAFTHAV
SAAGVVNAISRACREGELSTCGCSRTARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDARE
REKNFAKGSEEQGRVLMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRK
VGDRLKEKYDSAAAMRVTRKGRLELVNSRFTQPTPEDLVYVDPSPDYCLRNESTGSLGTQ
GRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCTEIVDQYICK
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgcccagcctgctgctgctgttcacggctgctctgctgtccagctgggctcagcttctg
acagacgccaactcctggtggtcattagctttgaacccggtgcagagacccgagatgttt
atcatcggtgcccagcccgtgtgcagtcagcttcccgggctctcccctggccagaggaag
ctgtgccaattgtaccaggagcacatggcctacataggggagggagccaagactggcatc
aaggaatgccagcaccagttccggcagcggcggtggaattgcagcacagcggacaacgca
tctgtctttgggagagtcatgcagataggcagccgagagaccgccttcacccacgcggtg
agcgccgcgggcgtggtcaacgccatcagccgggcctgccgcgagggcgagctctccacc
tgcggctgcagccggacggcgcggcccaaggacctgccccgggactggctgtggggcggc
tgtggggacaacgtggagtacggctaccgcttcgccaaggagtttgtggatgcccgggag
cgagagaagaactttgccaaaggatcagaggagcagggccgggtgctcatgaacctgcaa
aacaacgaggccggtcgcagggctgtgtataagatggcagacgtagcctgcaaatgccac
ggcgtctcggggtcctgcagcctcaagacctgctggctgcagctggccgagttccgcaag
gtcggggaccggctgaaggagaagtacgacagcgcggccgccatgcgcgtcacccgcaag
ggccggctggagctggtcaacagccgcttcacccagcccaccccggaggacctggtctat
gtggaccccagccccgactactgcctgcgcaacgagagcacgggctccctgggcacgcag
ggccgcctctgcaacaagacctcggagggcatggatggctgtgagctcatgtgctgcggg
cgtggctacaaccagttcaagagcgtgcaggtggagcgctgccactgcaagttccactgg
tgctgcttcgtcaggtgtaagaagtgcacggagatcgtggaccagtacatctgtaaatag

KEGG   Homo sapiens (human): 7475
Entry
7475              CDS       T01001                                 
Symbol
WNT6
Name
(RefSeq) Wnt family member 6
  KO
K00445  wingless-type MMTV integration site family, member 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
nt06505  WNT signaling
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N01442  Wnt signaling modulation, Wnt inhibitor
N01443  Wnt signaling modulation, Wnt acylation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7475 (WNT6)
   04390 Hippo signaling pathway
    7475 (WNT6)
   04150 mTOR signaling pathway
    7475 (WNT6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7475 (WNT6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7475 (WNT6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7475 (WNT6)
   05205 Proteoglycans in cancer
    7475 (WNT6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7475 (WNT6)
   05226 Gastric cancer
    7475 (WNT6)
   05217 Basal cell carcinoma
    7475 (WNT6)
   05224 Breast cancer
    7475 (WNT6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7475 (WNT6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    7475 (WNT6)
   05022 Pathways of neurodegeneration - multiple diseases
    7475 (WNT6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7475 (WNT6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7475 (WNT6)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Morphogens
   7475 (WNT6)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 7475
NCBI-ProteinID: NP_006513
OMIM: 604663
HGNC: 12785
Ensembl: ENSG00000115596
Pharos: Q9Y6F9(Tbio)
UniProt: Q9Y6F9 Q8N2E5
LinkDB
Position
2:218859805..218874233
AA seq 365 aa
MLPPLPSRLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPE
VVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAV
TQACSMGELLQCGCQAPRGRAPPRPSGLPGTPGPPGPAGSPEGSAAWEWGGCGDDVDFGD
EKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKL
PPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRT
GSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKE
LSLCL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgctgccgcccttaccctcccgcctcgggctgctgctgctgctgctcctgtgcccggcg
cacgtcggcggactgtggtgggctgtgggcagccccttggttatggaccctaccagcatc
tgcaggaaggcacggcggctggccgggcggcaggccgagttgtgccaggctgagccggaa
gtggtggcagagctagctcggggcgcccggctcggggtgcgagagtgccagttccagttc
cgcttccgccgctggaattgctccagccacagcaaggcctttggacgcatcctgcaacag
gacattcgggagacggccttcgtgttcgccatcactgcggccggcgccagccacgccgtc
acgcaggcctgttctatgggcgagctgctgcagtgcggctgccaggcgccccgcgggcgg
gcccctccccggccctccggcctgcccggcacccccggaccccctggccccgcgggctcc
ccggaaggcagcgccgcctgggagtggggaggctgcggcgacgacgtggacttcggggac
gagaagtcgaggctctttatggacgcgcggcacaagcggggacgcggagacatccgcgcg
ttggtgcaactgcacaacaacgaggcgggcaggctggccgtgcggagccacacgcgcacc
gagtgcaaatgccacgggctgtcgggatcatgcgcgctgcgcacctgctggcagaagctg
cctccatttcgcgaggtgggcgcgcggctgctggagcgcttccacggcgcctcacgcgtc
atgggcaccaacgacggcaaggccctgctgcccgccgtccgcacgctcaagccgccgggc
cgagcggacctcctctacgccgccgattcgcccgacttctgcgcccccaaccgacgcacc
ggctcccccggcacgcgcggtcgcgcctgcaatagcagcgccccggacctcagcggctgc
gacctgctgtgctgcggccgcgggcaccgccaggagagcgtgcagctcgaagagaactgc
ctgtgccgcttccactggtgctgcgtagtacagtgccaccgctgccgtgtgcgcaaggag
ctcagcctctgcctgtga

KEGG   Homo sapiens (human): 7476
Entry
7476              CDS       T01001                                 
Symbol
WNT7A, Wnt-7a
Name
(RefSeq) Wnt family member 7A
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
nt06505  WNT signaling
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N01442  Wnt signaling modulation, Wnt inhibitor
N01443  Wnt signaling modulation, Wnt acylation
Disease
H00846  Fuhrmann syndrome
H00847  Al-Awadi/Raas-Rothschild syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7476 (WNT7A)
   04390 Hippo signaling pathway
    7476 (WNT7A)
   04150 mTOR signaling pathway
    7476 (WNT7A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7476 (WNT7A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7476 (WNT7A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7476 (WNT7A)
   05205 Proteoglycans in cancer
    7476 (WNT7A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7476 (WNT7A)
   05226 Gastric cancer
    7476 (WNT7A)
   05217 Basal cell carcinoma
    7476 (WNT7A)
   05224 Breast cancer
    7476 (WNT7A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7476 (WNT7A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    7476 (WNT7A)
   05022 Pathways of neurodegeneration - multiple diseases
    7476 (WNT7A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7476 (WNT7A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7476 (WNT7A)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Morphogens
   7476 (WNT7A)
SSDB
Motif
Pfam: wnt COG6
Other DBs
NCBI-GeneID: 7476
NCBI-ProteinID: NP_004616
OMIM: 601570
HGNC: 12786
Ensembl: ENSG00000154764
Pharos: O00755(Tbio)
UniProt: O00755
Structure
LinkDB
Position
3:complement(13816258..13880071)
AA seq 349 aa
MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII
VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT
AACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLM
NLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEP
VRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaaccggaaagcgcggcgctgcctgggccacctctttctcagcctgggcatggtctac
ctccggatcggtggcttctcctcagtggtagctctgggcgcaagcatcatctgtaacaag
atcccaggcctggctcccagacagcgggcgatctgccagagccggcccgacgccatcatc
gtcataggagaaggctcacaaatgggcctggacgagtgtcagtttcagttccgcaatggc
cgctggaactgctctgcactgggagagcgcaccgtcttcgggaaggagctcaaagtgggg
agccgggaggctgcgttcacctacgccatcattgccgccggcgtggcccacgccatcaca
gctgcctgtacccagggcaacctgagcgactgtggctgcgacaaagagaagcaaggccag
taccaccgggacgagggctggaagtggggtggctgctctgccgacatccgctacggcatc
ggcttcgccaaggtctttgtggatgcccgggagatcaagcagaatgcccggactctcatg
aacttgcacaacaacgaggcaggccgaaagatcctggaggagaacatgaagctggaatgt
aagtgccacggcgtgtcaggctcgtgcaccaccaagacgtgctggaccacactgccacag
tttcgggagctgggctacgtgctcaaggacaagtacaacgaggccgttcacgtggagcct
gtgcgtgccagccgcaacaagcggcccaccttcctgaagatcaagaagccactgtcgtac
cgcaagcccatggacacggacctggtgtacatcgagaagtcgcccaactactgcgaggag
gacccggtgaccggcagtgtgggcacccagggccgcgcctgcaacaagacggctccccag
gccagcggctgtgacctcatgtgctgtgggcgtggctacaacacccaccagtacgcccgc
gtgtggcagtgcaactgtaagttccactggtgctgctatgtcaagtgcaacacgtgcagc
gagcgcacggagatgtacacgtgcaagtga

DBGET integrated database retrieval system