KEGG   Homo sapiens (human): 7498
Entry
7498              CDS       T01001                                 
Symbol
XDH, XAN1, XO, XOR
Name
(RefSeq) xanthine dehydrogenase
  KO
K00106  xanthine dehydrogenase/oxidase [EC:1.17.1.4 1.17.3.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00232  Caffeine metabolism
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01232  Nucleotide metabolism
hsa04146  Peroxisome
Module
hsa_M00958  Adenine ribonucleotide degradation, AMP => Urate
hsa_M00959  Guanine ribonucleotide degradation, GMP => Urate
Network
nt06025  Molybdenum cofactor biosynthesis
nt06027  Purine salvage pathway
  Element
N00888  Hypoxanthine oxidation
N01420  APRT deficiency in adenine metabolism
N01423  HPRT1 deficiency in hypoxanthine metabolism
N01424  HPRT1 deficiency in guanine metabolism
Disease
H00192  Xanthinuria
Drug target
Allopurinol (DG00779): D00224<JP/US> D07564<US>
Amflutizole: D02896
Febuxostat (DG02878): D01206<JP/US> D11081<JP/US>
Oxypurinol: D02365
Tisopurine: D07278
Topiroxostat: D09786<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    7498 (XDH)
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    7498 (XDH)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    7498 (XDH)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    7498 (XDH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7498 (XDH)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     7498 (XDH)
   1.17.3  With oxygen as acceptor
    1.17.3.2  xanthine oxidase
     7498 (XDH)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   7498 (XDH)
SSDB
Motif
Pfam: MoCoBD_1 MoCoBD_2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2 DHODB_Fe-S_bind
Other DBs
NCBI-GeneID: 7498
NCBI-ProteinID: NP_000370
OMIM: 607633
HGNC: 12805
Ensembl: ENSG00000158125
Pharos: P47989(Tclin)
UniProt: P47989
Structure
LinkDB
Position
2:complement(31334321..31414742)
AA seq 1333 aa
MTADKLVFFVNGRKVVEKNADPETTLLAYLRRKLGLSGTKLGCGEGGCGACTVMLSKYDR
LQNKIVHFSANACLAPICSLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGI
VMSMYTLLRNQPEPTMEEIENAFQGNLCRCTGYRPILQGFRTFARDGGCCGGDGNNPNCC
MNQKKDHSVSLSPSLFKPEEFTPLDPTQEPIFPPELLRLKDTPRKQLRFEGERVTWIQAS
TLKELLDLKAQHPDAKLVVGNTEIGIEMKFKNMLFPMIVCPAWIPELNSVEHGPDGISFG
AACPLSIVEKTLVDAVAKLPAQKTEVFRGVLEQLRWFAGKQVKSVASVGGNIITASPISD
LNPVFMASGAKLTLVSRGTRRTVQMDHTFFPGYRKTLLSPEEILLSIEIPYSREGEYFSA
FKQASRREDDIAKVTSGMRVLFKPGTTEVQELALCYGGMANRTISALKTTQRQLSKLWKE
ELLQDVCAGLAEELHLPPDAPGGMVDFRCTLTLSFFFKFYLTVLQKLGQENLEDKCGKLD
PTFASATLLFQKDPPADVQLFQEVPKGQSEEDMVGRPLPHLAADMQASGEAVYCDDIPRY
ENELSLRLVTSTRAHAKIKSIDTSEAKKVPGFVCFISADDVPGSNITGICNDETVFAKDK
VTCVGHIIGAVVADTPEHTQRAAQGVKITYEELPAIITIEDAIKNNSFYGPELKIEKGDL
KKGFSEADNVVSGEIYIGGQEHFYLETHCTIAVPKGEAGEMELFVSTQNTMKTQSFVAKM
LGVPANRIVVRVKRMGGGFGGKETRSTVVSTAVALAAYKTGRPVRCMLDRDEDMLITGGR
HPFLARYKVGFMKTGTVVALEVDHFSNVGNTQDLSQSIMERALFHMDNCYKIPNIRGTGR
LCKTNLPSNTAFRGFGGPQGMLIAECWMSEVAVTCGMPAEEVRRKNLYKEGDLTHFNQKL
EGFTLPRCWEECLASSQYHARKSEVDKFNKENCWKKRGLCIIPTKFGISFTVPFLNQAGA
LLHVYTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIYISETSTNTVPNTSPTAA
SVSADLNGQAVYAACQTILKRLEPYKKKNPSGSWEDWVTAAYMDTVSLSATGFYRTPNLG
YSFETNSGNPFHYFSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAF
VQGLGLFTLEELHYSPEGSLHTRGPSTYKIPAFGSIPIEFRVSLLRDCPNKKAIYASKAV
GEPPLFLAASIFFAIKDAIRAARAQHTGNNVKELFRLDSPATPEKIRNACVDKFTTLCVT
GVPENCKPWSVRV
NT seq 4002 nt   +upstreamnt  +downstreamnt
atgacagcagacaaattggttttctttgtgaatggcagaaaggtggtggagaaaaatgca
gatccagagacaacccttttggcctacctgagaagaaagttggggctgagtggaaccaag
ctcggctgtggagaggggggctgcggggcttgcacagtgatgctctccaagtatgatcgt
ctgcagaacaagatcgtccacttttctgccaatgcctgcctggcccccatctgctccttg
caccatgttgcagtgacaactgtggaaggaataggaagcaccaagacgaggctgcatcct
gtgcaggagagaattgccaaaagccacggctcccagtgcgggttctgcacccctggcatc
gtcatgagtatgtacacactgctccggaatcagcccgagcccaccatggaggagattgag
aatgccttccaaggaaatctgtgccgctgcacaggctacagacccatcctccagggcttc
cggacctttgccagggatggtggatgctgtggaggagatgggaataatccaaattgctgc
atgaaccagaagaaagaccactcagtcagcctctcgccatctttattcaaaccagaggag
ttcacgcccctggatccaacccaggagcccatttttcccccagagttgctgaggctgaaa
gacactcctcggaagcagctgcgatttgaaggggagcgtgtgacgtggatacaggcctca
accctcaaggagctgctggacctcaaggctcagcaccctgacgccaagctggtcgtgggg
aacacggagattggcattgagatgaagttcaagaatatgctgtttcctatgattgtctgc
ccagcctggatccctgagctgaattcggtagaacatggacccgacggtatctcctttgga
gctgcttgccccctgagcattgtggaaaaaaccctggtggatgctgttgctaagcttcct
gcccaaaagacagaggtgttcagaggggtcctggagcagctgcgctggtttgctgggaag
caagtcaagtctgtggcgtccgttggagggaacatcatcactgccagccccatctccgac
ctcaaccccgtgttcatggccagtggggccaagctgacacttgtgtccagaggcaccagg
agaactgtccagatggaccacaccttcttccctggctacagaaagaccctgctgagcccg
gaggagatactgctctccatagagatcccctacagcagggagggggagtatttctcagca
ttcaagcaggcctcccggagagaagatgacattgccaaggtaaccagtggcatgagagtt
ttattcaagccaggaaccacagaggtacaggagctggccctttgctatggtggaatggcc
aacagaaccatctcagccctcaagaccactcagaggcagctttccaagctctggaaggag
gagctgctgcaggacgtgtgtgcaggactggcagaggagctgcatctgcctcccgatgcc
cctggtggcatggtggacttccggtgcaccctcaccctcagcttcttcttcaagttctac
ctgacagtccttcagaagctgggccaagagaacctggaagacaagtgtggtaaactggac
cccactttcgccagtgcaactttactgtttcagaaagaccccccagccgatgtccagctc
ttccaagaggtgcccaagggtcagtctgaggaggacatggtgggccggcccctgccccac
ctggcagcggacatgcaggcctctggtgaggccgtgtactgtgacgacattcctcgctac
gagaatgagctgtctctccggctggtcaccagcacccgggcccacgccaagatcaagtcc
atagatacatcagaagctaagaaggttccagggtttgtttgtttcatttccgctgatgat
gttcctgggagtaacataactggaatttgtaatgatgagacagtctttgcgaaggataag
gttacttgtgttgggcatatcattggtgctgtggttgctgacaccccggaacacacacag
agagctgcccaaggggtgaaaatcacctatgaagaactaccagccattatcacaattgag
gatgctataaagaacaactccttttatggacctgagctgaagatcgagaaaggggaccta
aagaaggggttttccgaagcagataatgttgtgtcaggggagatatacatcggtggccaa
gagcacttctacctggagactcactgcaccattgctgttccaaaaggcgaggcaggggag
atggagctctttgtgtctacacagaacaccatgaagacccagagctttgttgcaaaaatg
ttgggggttccagcaaaccggattgtggttcgagtgaagagaatgggaggaggctttgga
ggcaaggagacccggagcactgtggtgtccacggcagtggccctggctgcatataagacc
ggccgccctgtgcgatgcatgctggaccgtgatgaggacatgctgataactggtggcaga
catcccttcctggccagatacaaggttggcttcatgaagactgggacagttgtggctctt
gaggtggaccacttcagcaatgtggggaacacccaggatctctctcagagtattatggaa
cgagctttattccacatggacaactgctataaaatccccaacatccggggcactgggcgg
ctgtgcaaaaccaaccttccctccaacacggccttccggggctttggggggccccagggg
atgctcattgccgagtgctggatgagtgaagttgcagtgacctgtgggatgcctgcagag
gaggtgcggagaaaaaacctgtacaaagaaggggacctgacacacttcaaccagaagctt
gagggtttcaccttgcccagatgctgggaagaatgcctagcaagctctcagtatcatgct
cggaagagtgaggttgacaagttcaacaaggagaattgttggaaaaagagaggattgtgc
ataattcccaccaagtttggaataagctttacagttccttttctgaatcaggcaggagcc
ctacttcatgtgtacacagatggctctgtgctgctgacccacggggggactgagatgggc
caaggccttcataccaaaatggtccaggtggccagtagagctctgaaaatccccacctct
aagatttatatcagcgagacaagcactaacactgtgcccaacacctctcccacggctgcc
tctgtcagcgctgacctcaatggacaggccgtctatgcggcttgtcagaccatcttgaaa
aggctggaaccctacaagaagaagaatcccagtggctcctgggaagactgggtcacagct
gcctacatggacacagtgagcttgtctgccactgggttttatagaacacccaatctgggc
tacagctttgagactaactcagggaaccccttccactacttcagctatggggtggcttgc
tctgaagtagaaatcgactgcctaacaggagatcataagaacctccgcacagatattgtc
atggatgttggctccagtctaaaccctgccattgatattggacaggtggaaggggcattt
gtccagggccttggcctcttcaccctagaggagctacactattcccccgaggggagcctg
cacacccgtggccctagcacctacaagatcccggcatttggcagcatccccattgagttc
agggtgtccctgctccgcgactgccccaacaagaaggccatctatgcatcgaaggctgtt
ggagagccgcccctcttcctggctgcttctatcttctttgccatcaaagatgccatccgt
gcagctcgagctcagcacacaggtaataacgtgaaggaactcttccggctagacagccct
gccaccccggagaagatccgcaatgcctgcgtggacaagttcaccaccctgtgtgtcact
ggtgtcccagaaaactgcaaaccctggtctgtgagggtctaa

DBGET integrated database retrieval system