KEGG   Homo sapiens (human): 79365
Entry
79365             CDS       T01001                                 
Symbol
BHLHE41, BHLHB3, DEC2, FNSS1, SHARP1, hDEC2
Name
(RefSeq) basic helix-loop-helix family member e41
  KO
K03730  class B basic helix-loop-helix protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    79365 (BHLHE41)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    79365 (BHLHE41)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    79365 (BHLHE41)
SSDB
Motif
Pfam: HLH Hairy_orange Oscp1
Other DBs
NCBI-GeneID: 79365
NCBI-ProteinID: NP_110389
OMIM: 606200
HGNC: 16617
Ensembl: ENSG00000123095
Pharos: Q9C0J9(Tbio)
UniProt: Q9C0J9 Q8TAT1 A0A024RAV8
LinkDB
Position
12:complement(26120030..26125037)
AA seq 482 aa
MDEGIPHLQERQLLEHRDFIGLDYSSLYMCKPKRSMKRDDTKDTYKLPHRLIEKKRRDRI
NECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHLKALTALTEQQHQKIIALQNGERSL
KSPIQSDLDAFHSGFQTCAKEVLQYLSRFESWTPREPRCVQLINHLHAVATQFLPTPQLL
TQQVPLSKGTGAPSAAGSAAAPCLERAGQKLEPLAYCVPVIQRTQPSAELAAENDTDTDS
GYGGEAEARPDREKGKGAGASRVTIKQEPPGEDSPAPKRMKLDSRGGGSGGGPGGGAAAA
AAALLGPDPAAAAALLRPDAALLSSLVAFGGGGGAPFPQPAAAAAPFCLPFCFLSPSAAA
AYVQPFLDKSGLEKYLYPAAAAAPFPLLYPGIPAPAAAAAAAAAAAAAAAAFPCLSSVLS
PPPEKAGAAAATLLPHEVAPLGAPHPQHPHGRTHLPFAGPREPGNPESSAQEDPSQPGKE
AP
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggacgaaggaattcctcatttgcaagagagacagttactggaacatagagattttata
ggactggactattcctctttgtatatgtgtaaacccaaaaggagcatgaaacgagacgac
accaaggatacctacaaattaccgcacagattaatagaaaagaaaagaagagaccgaatt
aatgaatgcattgctcagctgaaagatttactgcctgaacatctgaaattgacaactctg
ggacatctggagaaagctgtagtcttggaattaactttgaaacacttaaaagctttaacc
gccttaaccgagcaacagcatcagaagataattgctttacagaatggggagcgatctctg
aaatcgcccattcagtccgacttggatgcgttccactcgggatttcaaacatgcgccaaa
gaagtcttgcaatacctctcccggtttgagagctggacacccagggagccgcggtgtgtc
cagctgatcaaccacttgcacgccgtggccacccagttcttgcccaccccgcagctgttg
actcaacaggtccctctgagcaaaggcaccggcgctccctcggccgccgggtccgcggcc
gccccctgcctggagcgcgcggggcagaagctggagcccctcgcctactgcgtgcccgtc
atccagcggactcagcccagcgccgagctcgccgccgagaacgacacggacaccgacagc
ggctacggcggcgaagccgaggcccggccggaccgcgagaaaggcaaaggcgcgggggcg
agccgcgtcaccatcaagcaggagcctcccggggaggactcgccggcgcccaagaggatg
aagctggattcccgcggcggcggcagcggcggcggcccggggggcggcgcggcggcggcg
gcagccgcgcttctggggcccgaccctgccgccgcggccgcgctgctgagacccgacgcc
gccctgctcagctcgctggtggcgttcggcggaggcggaggcgcgcccttcccgcagccc
gcggccgccgcggcccccttctgcctgcccttctgcttcctctcgccttctgcagctgcc
gcctacgtgcagcccttcctggacaagagcggcctggagaagtatctgtacccggcggcg
gctgccgccccgttcccgctgctataccccggcatccccgccccggcggcagccgcggca
gccgccgccgccgctgccgccgccgccgccgcgttcccctgcctgtcctcggtgttgtcg
ccccctcccgagaaggcgggcgccgccgccgcgaccctcctgccgcacgaggtggcgccc
cttggggcgccgcacccccagcacccgcacggccgcacccacctgcccttcgccgggccc
cgcgagccggggaacccggagagctctgctcaggaagatccctcgcagccaggaaaggaa
gctccctga

KEGG   Homo sapiens (human): 8553
Entry
8553              CDS       T01001                                 
Symbol
BHLHE40, BHLHB2, Clast5, DEC1, HLHB2, SHARP-2, SHARP2, STRA13, Stra14
Name
(RefSeq) basic helix-loop-helix family member e40
  KO
K03729  class B basic helix-loop-helix protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    8553 (BHLHE40)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    8553 (BHLHE40)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    8553 (BHLHE40)
SSDB
Motif
Pfam: HLH Hairy_orange Oscp1
Other DBs
NCBI-GeneID: 8553
NCBI-ProteinID: NP_003661
OMIM: 604256
HGNC: 1046
Ensembl: ENSG00000134107
Pharos: O14503(Tbio)
UniProt: O14503 Q6IB83
LinkDB
Position
3:4979437..4985323
AA seq 412 aa
MERIPSAQPPPACLPKAPGLEHGDLPGMYPAHMYQVYKSRRGIKRSEDSKETYKLPHRLI
EKKRRDRINECIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIA
LQSGLQAGELSGRNVETGQEMFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVS
ELLQGGTSRKPSDPAPKVMDFKEKPSSPAKGSEGPGKNCVPVIQRTFAHSSGEQSGSDTD
TDSGYGGESEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDEGH
FTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPVLYPGLNASAA
ALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQALKPIPPLNLETKD
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggagcggatccccagcgcgcaaccaccccccgcctgcctgcccaaagcaccgggactg
gagcacggagacctaccagggatgtaccctgcccacatgtaccaagtgtacaagtcaaga
cggggaataaagcggagcgaggacagcaaggagacctacaaattgccgcaccggctcatc
gagaaaaagagacgtgaccggattaacgagtgcatcgcccagctgaaggatctcctaccc
gaacatctcaaacttacaactttgggtcacttggaaaaagcagtggttcttgaacttacc
ttgaagcatgtgaaagcactaacaaacctaattgatcagcagcagcagaaaatcattgcc
ctgcagagtggtttacaagctggtgagctgtcagggagaaatgtcgaaacaggtcaagag
atgttctgctcaggtttccagacatgtgcccgggaggtgcttcagtatctggccaagcac
gagaacactcgggacctgaagtcttcgcagcttgtcacccacctccaccgggtggtctcg
gagctgctgcagggtggtacctccaggaagccatcagacccagctcccaaagtgatggac
ttcaaggaaaaacccagctctccggccaaaggttcggaaggtcctgggaaaaactgcgtg
ccagtcatccagcggactttcgctcactcgagtggggagcagagcggcagcgacacggac
acagacagtggctatggaggagaatcggagaagggcgacttgcgcagtgagcagccgtgc
ttcaaaagtgaccacggacgcaggttcacgatgggagaaaggatcggcgcaattaagcaa
gagtccgaagaaccccccacaaaaaagaaccggatgcagctttcggatgatgaaggccat
ttcactagcagtgacctgatcagctccccgttcctgggcccacacccacaccagcctcct
ttctgcctgcccttctacctgatcccaccttcagcgactgcctacctgcccatgctggag
aagtgctggtatcccacctcagtgccagtgctatacccaggcctcaacgcctctgccgca
gccctctctagcttcatgaacccagacaagatctcggctcccttgctcatgccccagaga
ctcccttctcccttgccagctcatccgtccgtcgactcttctgtcttgctccaagctctg
aagccaatcccccctttaaacttagaaaccaaagactaa

DBGET integrated database retrieval system