KEGG   Homo sapiens (human): 80198
Entry
80198             CDS       T01001                                 

Gene name
MUS81, SLX3
Definition
(RefSeq) MUS81 structure-specific endonuclease subunit
  KO
K08991  crossover junction endonuclease MUS81 [EC:3.1.22.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03440  Homologous recombination
hsa03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    80198 (MUS81)
   03460 Fanconi anemia pathway
    80198 (MUS81)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    80198 (MUS81)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.-  
     80198 (MUS81)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     80198 (MUS81)
SSDB
Motif
Pfam: ERCC4 HHH_8 MutL
Other DBs
NCBI-GeneID: 80198
NCBI-ProteinID: NP_079404
OMIM: 606591
HGNC: 29814
Ensembl: ENSG00000172732
Vega: OTTHUMG00000166633
Pharos: Q96NY9(Tbio)
UniProt: Q96NY9 Q53ES5
LinkDB
Structure
PDB: 

Position
11q13.1
AA seq 551 aa
MAAPVRLGRKRPLPACPNPLFVRWLTEWRDEATRSRRRTRFVFQKALRSLRRYPLPLRSG
KEAKILQHFGDGLCRMLDERLQRHRTSGGDHAPDSPSGENSPAPQGRLAEVQDSSMPVPA
QPKAGGSGSYWPARHSGARVILLVLYREHLNPNGHHFLTKEELLQRCAQKSPRVAPGSAR
PWPALRSLLHRNLVLRTHQPARYSLTPEGLELAQKLAESEGLSLLNVGIGPKEPPGEETA
VPGAASAELASEAGVQQQPLELRPGEYRVLLCVDIGETRGGGHRPELLRELQRLHVTHTV
RKLHVGDFVWVAQETNPRDPANPGELVLDHIVERKRLDDLCSSIIDGRFREQKFRLKRCG
LERRVYLVEEHGSVHNLSLPESTLLQAVTNTQVIDGFFVKRTADIKESAAYLALLTRGLQ
RLYQGHTLRSRPWGTPGNPESGAMTSPNPLCSLLTFSDFNAGAIKNKAQSVREVFARQLM
QVRGVSGEKAAALVDRYSTPASLLAAYDACATPKEQETLLSTIKCGRLQRNLGPALSRTL
SQLYCSYGPLT
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggcggccccggtccgcctgggccggaagcgcccgctgcctgcctgtcccaacccgctc
ttcgttcgctggctgaccgagtggcgggacgaggcgacccgcagcaggcgccgcacgcgc
ttcgtatttcagaaggcgctgcgttccctccgacggtacccactgccgctgcgcagcggg
aaggaagctaagatcctacagcacttcggagacgggctctgccggatgctggacgagcgg
ctgcagcggcaccgaacatcgggcggtgaccatgccccggactcaccatctggagagaac
agtccagccccgcaggggcgacttgcggaagtccaggactcttccatgccagttcctgcc
cagcccaaagcgggaggctctggcagctactggccagctcggcactcaggagcccgagtg
atactgctggtgctctaccgggagcacctgaatcctaatggtcaccacttcttaaccaag
gaggagctgctgcagaggtgtgctcagaagtcccccagggtagcccctgggagtgctcga
ccctggccagccctccgctccctccttcacaggaacctggtcctcaggacacaccagcca
gccaggtactcattgaccccagagggcctggagctggcccagaagttggccgagtcagaa
ggcctgagcttgctgaatgtgggcatcgggcccaaggagccccctggggaggagacagca
gtgccaggagcagcttcagcagagcttgccagtgaagcaggggtccagcagcagccactg
gagctgaggcctggagagtacagggtgctgttgtgtgtggacattggcgagacccggggg
ggcgggcacaggccggagctgctccgagagctacagcggctgcacgtgacccacacggtg
cgcaagctgcacgttggagattttgtgtgggtggcccaggagaccaatcctagagaccca
gcaaaccctggggagttggtactggatcacattgtggagcgcaagcgactggatgacctt
tgcagcagcatcatcgacggccgcttccgggagcagaagttccggctgaagcgctgtggt
ctggagcgccgggtatacctggtggaagagcatggttccgtccacaacctcagccttcct
gagagcacactgctgcaggctgtcaccaacactcaggtcattgatggcttttttgtgaag
cgcacagcagacattaaggagtcagccgcctacctggccctcttgacgcggggcctgcag
agactctaccagggccacaccctacgcagccgcccctggggaacccctgggaaccctgaa
tcaggggccatgacctctccaaaccctctctgctcactcctcaccttcagtgacttcaac
gcaggagccatcaagaataaggcccagtcggtgcgagaagtgtttgcccggcagctgatg
caggtgcgcggagtgagtggggagaaggcagcagccctggtggatcgatacagcacccct
gccagcctcctggccgcctatgatgcctgtgccacccccaaggaacaagagacactgctg
agcaccattaagtgtgggcgtctacagaggaatctggggcctgctctgagcaggacctta
tcccagctctactgcagctacggccccttgacctga

DBGET integrated database retrieval system