KEGG   Homo sapiens (human): 80233
Entry
80233             CDS       T01001                                 
Symbol
FAAP100, C17orf70
Name
(RefSeq) FA core complex associated protein 100
  KO
K10993  fanconi anemia core complex 100 kDa subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    80233 (FAAP100)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    80233 (FAAP100)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex
     80233 (FAAP100)
SSDB
Motif
Pfam: FANCAA
Other DBs
NCBI-GeneID: 80233
NCBI-ProteinID: NP_079437
OMIM: 611301
HGNC: 26171
Ensembl: ENSG00000185504
Vega: OTTHUMG00000167764
Pharos: Q0VG06(Tdark)
UniProt: Q0VG06 A4ZI32
Structure
LinkDB
Position
17:complement(81539891..81553133)
AA seq 881 aa
MAGAAPRVRYLAGFCCPLGGLAAGKPRVLCHEAEVFLSTGSELVYVYDQEGGLLTAAFRF
PDQVWHLELLAPRRLLYALCARRGLYCLSLDHPGRSRSTSQDDRDSEDGDQPSPVIPVDP
DACILPDAALCAFTLLDSVLVTLVQGPARWKMQLFEQPCPGEDPRPGGQIGEVELSSYTP
PAGVPGKPAAPHFLPVLCSVSPSGSRVPHDLLGGSGGFTLEDALFGLLFGADATLLQSPV
VLCGLPDGQLCCVILKALVTSRSAPGDPNALVKILHHLEEPVIFIGALKTEPQAAEAAEN
FLPDEDVHCDCLVAFGHHGRMLAIKASWDESGKLVPELREYCLPGPVLCAACGGGGRVYH
STPSDLCVVDLSRGSTPLGPEQPEEGPGGLPPMLCPASLNICSVVSLSASPRTHEGGTKL
LALSAKGRLMTCSLDLDSEMPGPARMTTESAGQKIKELLSGIGNISERVSFLKKAVDQRN
KALTSLNEAMNVSCALLSSGTGPRPISCTTSTTWSRLQTQDVLMATCVLENSSSFSLDQG
WTLCIQVLTSSCALDLDSACSAITYTIPVDQLGPGARREVTLPLGPGENGGLDLPVTVSC
TLFYSLREVVGGALAPSDSEDPFLDECPSDVLPEQEGVCLPLSRHTVDMLQCLRFPGLAP
PHTRAPSPLGPTRDPVATFLETCREPGSQPAGPASLRAEYLPPSVASIKVSAELLRAALK
DGHSGVPLCCATLQWLLAENAAVDVVRARALSSIQGVAPDGANVHLIVREVAMTDLCPAG
PIQAVEIQVESSSLADICRAHHAVVGRMQTMVTEQATQGSSAPDLRVQYLRQIHANHETL
LREVQTLRDRLCTEDEASSCATAQRLLQVYRQLRHPSLILL
NT seq 2646 nt   +upstreamnt  +downstreamnt
atggccggcgccgcgccgcgggtccgctacctggcgggcttctgctgccctctcgggggc
ctggcggcgggcaagccccgcgtgctgtgccatgaggcagaggtcttcctgtccaccggg
agcgagctcgtctacgtgtacgaccaggagggcgggctgctgaccgcggcgttccggttc
cccgaccaggtgtggcacctggagctgctggcgccgcgcaggttgctgtacgcgctgtgc
gcccggaggggcctctactgcctgtcgctggaccacccgggcaggagcaggtctacgagc
caggatgacagggacagcgaggacggtgaccagccttcccccgtgatccctgtggacccc
gatgcctgcatccttcccgatgctgcgctgtgcgcgttcaccttgctggacagtgtgctg
gtcaccctggtgcagggccctgcccgatggaagatgcagctgtttgagcagccctgtcct
ggggaggacccccggccaggaggccagatcggtgaggtggagctgtcctcctacacgccc
ccagccggggtcccaggaaagcctgcagccccccacttccttccagtgctgtgctctgtg
tcaccatcaggctccagggtcccgcacgacctcctcgggggctccgggggcttcacgctg
gaggacgccctcttcgggctcctctttggagctgatgccaccctcctgcagtcacctgtg
gtcctctgtggtctccctgatggccagctctgctgtgtgatcctgaaggccctggtcacc
tccaggtcagcccctggtgacccaaatgcccttgtcaagatcctccatcacctggaggag
cccgtcatcttcataggggccttgaagacagagccacaggctgcagaagctgcagagaat
tttctgcctgacgaggatgtgcactgtgactgcctggtggcctttggtcaccacggccgg
atgctggccatcaaggccagctgggatgagtccgggaagctggtgcccgagctgcgggag
tactgcctcccaggccctgtgctctgcgctgcctgtggcgggggtggccgcgtgtaccac
agcaccccttctgacctctgtgtggtggatctgtctcggggaagcaccccgctgggccct
gagcagcccgaagaaggcccgggaggcctgccccccatgctgtgcccagccagcctgaac
atctgcagtgtcgtctcgctgtccgcgtctcccaggacgcatgaaggtggcaccaagctc
ctggccctgtccgccaaaggccgcctgatgacctgcagcctggacctggactctgagatg
cctggcccagccaggatgaccacagagagtgcaggtcagaaaataaaggagctgctgtct
ggaattggcaacatctctgagagagtgtcttttctaaagaaggcggttgaccagcggaac
aaggcactgacaagcctcaacgaggccatgaacgtgagctgtgcactgctgtcaagcggc
acgggccccagacccatctcctgcaccaccagcaccacctggagccgcctgcagacacag
gatgtgctcatggccacctgcgtgctagagaacagcagcagcttcagcctggaccagggg
tggaccctgtgcatccaggtgctcaccagctcctgtgctctcgacctggactcggcctgc
tccgccatcacctacaccatccccgtggaccagctcggccccggtgctcggcgggaggtg
acgctacccctgggccctggtgagaacggcgggctcgacctgcccgtgaccgtgtcctgc
acgctgttctacagtctcagggaggtggtgggcggggcccttgccccctcagactctgag
gacccctttctggatgagtgcccctccgacgtcctgcccgagcaagagggtgtttgcctg
cccctgagcaggcacacagtggacatgctgcagtgtctgcgcttccctggcctggccccg
ccacacacacgggccccctccccactcggccccacccgagaccctgtggccacttttctg
gaaacttgtcgggagcctggcagccagccagcaggacccgcctccctgcgggccgagtac
ctgcccccatctgtggcttccatcaaggtgtcggcggagctgctcagagctgccttgaag
gacggccactcaggcgtgcccctgtgctgtgccaccctgcagtggctccttgctgagaat
gctgctgtggacgtcgtgagggcccgagcactatcttccatccagggagtggcccctgat
ggcgccaacgttcacctcatcgtccgagaggtggccatgactgacctgtgcccagcaggg
cccatccaggccgtggagattcaagtggaaagctcctctctggccgacatttgcagggcg
caccatgccgttgtcgggcgcatgcagacgatggtgacagagcaggccacccagggctcc
agcgctcctgatctccgtgtgcagtacctccgccagatccacgccaaccacgagacactg
ctgcgggaggtgcagaccctgcgcgaccggctctgcacggaggatgaggccagctcctgt
gccaccgcccagaggctgctacaggtgtaccggcagctgcgccaccccagcctcatcctg
ctgtga

DBGET integrated database retrieval system