KEGG   Homo sapiens (human): 80712
Entry
80712             CDS       T01001                                 
Symbol
ESX1, ESX1L, ESXR1
Name
(RefSeq) ESX homeobox 1
  KO
K18491  homeobox protein ESX1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    80712 (ESX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    80712 (ESX1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain Paired-related
    80712 (ESX1)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 80712
NCBI-ProteinID: NP_703149
OMIM: 300154
HGNC: 14865
Ensembl: ENSG00000123576
Vega: OTTHUMG00000022125
Pharos: Q8N693(Tbio)
UniProt: Q8N693
LinkDB
Position
X:complement(104250038..104254933)
AA seq 406 aa
MESLRGYTHSDIGYRSLAVGEDIEEVNDEKLTVTSLMARGGEDEENTRSKPEYGTEAENN
VGTEGSVPSDDQDREGGGGHEPEQQQEEPPLTKPEQQQEEPPLLELKQEQEEPPQTTVEG
PQPAEGPQTAEGPQPPERKRRRRTAFTQFQLQELENFFDESQYPDVVARERLAARLNLTE
DRVQVWFQNRRAKWKRNQRVLMLRNTATADLAHPLDMFLGGAYYAAPALDPALCVHLVPQ
LPRPPVLPVPPMPPRPPMVPMPPRPPIAPMPPMAPVPPGSRMAPVPPGPRMAPVPPWPPM
APVPPWPPMAPVPTGPPMAPVPPGPPMARVPPGPPMARVPPGPPMAPLPPGPPMAPLPPG
PPMAPLPPGPPMAPLPPRSHVPHTGLAPVHITWAPVINSYYACPFF
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggagtctcttcgcgggtacacccacagtgatattggctaccgcagcctggcagtcggc
gaggacatcgaggaagtgaatgatgagaaacttaccgtgacctcgctgatggcaagggga
ggagaggacgaggagaatacacggtccaaacctgagtacggaacagaagcggaaaacaac
gttggcacggaagggtccgtcccctcggacgaccaagaccgtgagggtggcggcggccac
gagccggagcaacagcaggaggagccgcccctgaccaagccggagcaacagcaggaggag
ccgcccctgctcgagctgaagcaagagcaggaggagccgccccagacgaccgtggagggg
ccacagccggcggaggggccacaaaccgctgagggaccacagcccccagagaggaaacgc
cgccgccgcaccgcgttcacgcagtttcagctgcaggagctagagaactttttcgatgaa
tctcaatatcccgacgttgtggcgcgagagagacttgcagcacgcctgaatttgactgaa
gacagagtgcaggtttggtttcagaacagaagagccaagtggaaacgaaatcagagggtg
ctaatgttgagaaacactgctactgctgacctggcccaccctttggacatgttcttgggt
ggggcctattatgctgctcctgctctggatcctgctttgtgtgttcatctggtgccacaa
ctacctagaccacctgtgctgcctgtgccacctatgccacccaggccacccatggtccct
atgccacccaggccacccatagcacctatgccacccatggcgcctgtgccacccggctca
cgcatggcgcctgtgccacccgggccacgcatggcgcctgtgccaccctggccgcccatg
gcgcctgtgccaccctggccgcccatggcgcctgtgccaaccgggccgcccatggcgcct
gtgccacccgggccgcccatggcgcgtgtgccacccgggccgcccatggcgcgtgtgcca
cccgggccgcccatggcgcctctgccacccgggccgcccatggcgcctctgccacccggg
ccgcccatggcgcctctgccacccgggccgcccatggcgcctctgccacccaggtcacat
gtgcctcacactggcctggctcctgtacacatcacatgggcccctgtcatcaacagttat
tatgcatgtccctttttctaa

DBGET integrated database retrieval system