KEGG   Homo sapiens (human): 81030
Entry
81030             CDS       T01001                                 
Symbol
ZBP1, C20orf183, DAI, DLM-1, DLM1
Name
(RefSeq) Z-DNA binding protein 1
  KO
K12965  Z-DNA binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04623  Cytosolic DNA-sensing pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    81030 (ZBP1)
 09150 Organismal Systems
  09151 Immune system
   04623 Cytosolic DNA-sensing pathway
    81030 (ZBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    81030 (ZBP1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     81030 (ZBP1)
   mRNA cycle factors
    Stress granule specific factors
     81030 (ZBP1)
SSDB
Motif
Pfam: z-alpha RHIM DprA_WH Malt_amylase_C
Other DBs
NCBI-GeneID: 81030
NCBI-ProteinID: NP_110403
OMIM: 606750
HGNC: 16176
Ensembl: ENSG00000124256
Pharos: Q9H171(Tbio)
UniProt: Q9H171
Structure
LinkDB
Position
20:complement(57603852..57620426)
AA seq 429 aa
MAQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSL
TSPATWCLGGTDPEGEGPAELALSSPAERPQQHAATIPETPGPQFSQQREEDIYRFLKDN
GPQRALVIAQALGMRTAKDVNRDLYRMKSRHLLDMDEQSKAWTIYRPEDSGRRAKSASII
YQHNPINMICQNGPNSWISIANSEAIQIGHGNIITRQTVSREDGSAGPRHLPSMAPGDSS
TWGTLVDPWGPQDIHMEQSILRRVQLGHSNEMRLHGVPSEGPAHIPPGSPPVSATAAGPE
ASFEARIPSPGTHPEGEAAQRIHMKSCFLEDATIGNSNKMSISPGVAGPGGVAGSGEGEP
GEDAGRRPADTQSRSHFPRDIGQPITPSHSKLTPKLETMTLGNRSHKAAEGSHYVDEASH
EGSWWGGGI
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggcccaggctcctgctgacccgggcagagaaggccaccttgaacaaagaatcctgcag
gtgctgacagaggctggctccccggtgaaacttgcccagctggtgaaggaatgccaagca
cccaagagggagctcaaccaagtcctctaccgaatgaaaaaggagttgaaagtctccctc
acatcccctgccacctggtgcttgggcgggactgatcctgaaggcgagggtcctgcagag
ctggccttgtccagccctgccgagaggccccagcaacatgcagctacaattccagagacc
cctggccctcagttcagccaacaacgggaggaagacatctacaggtttctcaaagacaat
ggtccccagagggccctggtcatcgcccaagcactgggaatgaggacagcaaaagatgtg
aaccgagacttgtacaggatgaagagcaggcaccttctggacatggatgagcagtccaaa
gcatggacgatttaccgcccagaagattctggaagaagagcaaagtcagcctcaattatt
taccagcacaatccaatcaacatgatctgccagaatggacccaacagctggatttccatt
gcaaactccgaagccatccagattggacacgggaacatcattacaagacagacagtctcc
agggaggacggttccgccggtccacgccacctcccttcaatggcaccaggtgattcctca
acttgggggaccctagttgatccctgggggccccaggacatccacatggagcagtccata
ctgagacgggtgcagctgggacacagcaatgagatgaggctccacggcgtcccgtccgag
ggccctgcccacatcccccctggcagccccccagtctctgccactgctgccggcccagaa
gcttcgtttgaagcaagaattcccagtccaggaactcaccctgagggggaagccgcccag
agaatccacatgaaatcgtgctttctcgaggacgccaccatcggcaacagcaacaaaatg
tctatcagcccaggggtggctggcccaggaggagtcgcagggtctggagagggggagcca
ggggaggacgcaggtcgtcgtcccgcagacacacaatccagaagtcactttcctcgagac
attggtcagcccatcactcccagccactcgaagctcacccccaagctggaaactatgact
cttggaaacaggagtcacaaagctgcagaaggcagccactatgtggatgaagcctcacac
gaggggagctggtggggaggtgggatttag

DBGET integrated database retrieval system