KEGG   Homo sapiens (human): 84818
Entry
84818             CDS       T01001                                 
Symbol
IL17RC, CANDF9, IL17-RL, IL17RL
Name
(RefSeq) interleukin 17 receptor C
  KO
K05166  interleukin 17 receptor C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04657  IL-17 signaling pathway
hsa04936  Alcoholic liver disease
Disease
H01109  Chronic mucocutaneous candidiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    84818 (IL17RC)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    84818 (IL17RC)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    84818 (IL17RC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    84818 (IL17RC)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL17 receptor family
   84818 (IL17RC)
SSDB
Motif
Pfam: IL17_R_N SEFIR
Other DBs
NCBI-GeneID: 84818
NCBI-ProteinID: NP_703191
OMIM: 610925
HGNC: 18358
Ensembl: ENSG00000163702
Pharos: Q8NAC3(Tclin)
UniProt: Q8NAC3
Structure
LinkDB
Position
3:9917098..9933621
AA seq 791 aa
MPVPWFLLSLALGRSPVVLSLERLVGPQDATHCSPVSLEPWGDEERLRVQFLAQQSLSLA
PVTAATARTALSGLSGADGRREERGRGKSWVCLSLGGSGNTEPQKKGLSCRLWDSDILCL
PGDIVPAPGPVLAPTHLQTELVLRCQKETDCDLCLRVAVHLAVHGHWEEPEDEEKFGGAA
DSGVEEPRNASLQAQVVLSFQAYPTARCVLLEVQVPAALVQFGQSVGSVVYDCFEAALGS
EVRIWSYTQPRYEKELNHTQQLPDCRGLEVWNSIPSCWALPWLNVSADGDNVHLVLNVSE
EQHFGLSLYWNQVQGPPKPRWHKNLTGPQIITLNHTDLVPCLCIQVWPLEPDSVRTNICP
FREDPRAHQNLWQAARLQLLTLQSWLLDAPCSLPAEAALCWRAPGGDPCQPLVPPLSWEN
VTVDKVLEFPLLKGHPNLCVQVNSSEKLQLQECLWADSLGPLKDDVLLLETRGPQDNRSL
CALEPSGCTSLPSKASTRAARLGEYLLQDLQSGQCLQLWDDDLGALWACPMDKYIHKRWA
LVWLACLLFAAALSLILLLKKDHAKGWLRLLKQDVRSGAAARGRAALLLYSADDSGFERL
VGALASALCQLPLRVAVDLWSRRELSAQGPVAWFHAQRRQTLQEGGVVVLLFSPGAVALC
SEWLQDGVSGPGAHGPHDAFRASLSCVLPDFLQGRAPGSYVGACFDRLLHPDAVPALFRT
VPVFTLPSQLPDFLGALQQPRAPRSGRLQERAEQVSRALQPALDSYFHPPGTPAPGRGVG
PGAGPGAGDGT
NT seq 2376 nt   +upstreamnt  +downstreamnt
atgcctgtgccctggttcttgctgtccttggcactgggccgaagcccagtggtcctttct
ctggagaggcttgtggggcctcaggacgctacccactgctctccggtgagtctggaaccc
tggggagacgaggaaaggctcagggttcagtttttggctcagcaaagccttagcctggct
cctgtcactgctgccactgccagaactgccctgtctggtctgtctggtgctgatggtaga
agagaagaacggggaaggggcaagagctgggtctgtctttctctgggagggtctgggaat
acggagccccagaaaaagggcctctcctgccgcctctgggacagtgacatactctgcctg
cctggggacatcgtgcctgctccgggccccgtgctggcgcctacgcacctgcagacagag
ctggtgctgaggtgccagaaggagaccgactgtgacctctgtctgcgtgtggctgtccac
ttggccgtgcatgggcactgggaagagcctgaagatgaggaaaagtttggaggagcagct
gactcaggggtggaggagcctaggaatgcctctctccaggcccaagtcgtgctctccttc
caggcctaccctactgcccgctgcgtcctgctggaggtgcaagtgcctgctgcccttgtg
cagtttggtcagtctgtgggctctgtggtatatgactgcttcgaggctgccctagggagt
gaggtacgaatctggtcctatactcagcccaggtacgagaaggaactcaaccacacacag
cagctgcctgactgcagggggctcgaagtctggaacagcatcccgagctgctgggccctg
ccctggctcaacgtgtcagcagatggtgacaacgtgcatctggttctgaatgtctctgag
gagcagcacttcggcctctccctgtactggaatcaggtccagggccccccaaaaccccgg
tggcacaaaaacctgactggaccgcagatcattaccttgaaccacacagacctggttccc
tgcctctgtattcaggtgtggcctctggaacctgactccgttaggacgaacatctgcccc
ttcagggaggacccccgcgcacaccagaacctctggcaagccgcccgactgcaactgctg
accctgcagagctggctgctggacgcaccgtgctcgctgcccgcagaagcggcactgtgc
tggcgggctccgggtggggacccctgccagccactggtcccaccgctttcctgggagaac
gtcactgtggacaaggttctcgagttcccattgctgaaaggccaccctaacctctgtgtt
caggtgaacagctcggagaagctgcagctgcaggagtgcttgtgggctgactccctgggg
cctctcaaagacgatgtgctactgttggagacacgaggcccccaggacaacagatccctc
tgtgccttggaacccagtggctgtacttcactacccagcaaagcctccacgagggcagct
cgccttggagagtacttactacaagacctgcagtcaggccagtgtctgcagctatgggac
gatgacttgggagcgctatgggcctgccccatggacaaatacatccacaagcgctgggcc
ctcgtgtggctggcctgcctactctttgccgctgcgctttccctcatcctccttctcaaa
aaggatcacgcgaaagggtggctgaggctcttgaaacaggacgtccgctcgggggcggcc
gccaggggccgcgcggctctgctcctctactcagccgatgactcgggtttcgagcgcctg
gtgggcgccctggcgtcggccctgtgccagctgccgctgcgcgtggccgtagacctgtgg
agccgtcgtgaactgagcgcgcaggggcccgtggcttggtttcacgcgcagcggcgccag
accctgcaggagggcggcgtggtggtcttgctcttctctcccggtgcggtggcgctgtgc
agcgagtggctacaggatggggtgtccgggcccggggcgcacggcccgcacgacgccttc
cgcgcctcgctcagctgcgtgctgcccgacttcttgcagggccgggcgcccggcagctac
gtgggggcctgcttcgacaggctgctccacccggacgccgtacccgcccttttccgcacc
gtgcccgtcttcacactgccctcccaactgccagacttcctgggggccctgcagcagcct
cgcgccccgcgttccgggcggctccaagagagagcggagcaagtgtcccgggcccttcag
ccagccctggatagctacttccatcccccggggactcccgcgccgggacgcggggtggga
ccaggcgcgggacctggggcgggggacgggacttaa

DBGET integrated database retrieval system