KEGG   Homo sapiens (human): 85315
Entry
85315             CDS       T01001                                 

Gene name
PAQR8, C6orf33, LMPB1, MPRB
Definition
(RefSeq) progestin and adipoQ receptor family member 8
  KO
K25040  membrane progestin receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa05207  Chemical carcinogenesis - receptor activation
Network
nt06214  PI3K signaling
  Element
N01356  Membrane-initiated progesterone signaling pathway
N01357  P4/MPA to membrane-initiated progesterone signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    85315 (PAQR8)
SSDB
Motif
Pfam: HlyIII DUF5504
Other DBs
NCBI-GeneID: 85315
NCBI-ProteinID: NP_588608
OMIM: 607780
HGNC: 15708
Ensembl: ENSG00000170915
Vega: OTTHUMG00000014846
Pharos: Q8TEZ7(Tbio)
UniProt: Q8TEZ7 B3KXW6
LinkDB
Position
6p12.2
AA seq 354 aa
MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVPETDVPQLFREPYIRTGYRPTGH
EWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFAEAEALPWASTHSLPLLLFILSSI
TYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYDRFWLFFL
PAAAFCGWLSCAGCCYAKYRYRRPYPVMRKICQVVPAGLAFILDISPVAHRVALCHLAGC
QEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAI
LLDYQGRQEIFLQRHGPLSVHMACLSFFFLAACSAATAALLRHKVKARLTKKDS
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgacgaccgccatcttggagcgcctgagcaccctgtcggtcagcgggcagcagctgcgc
cgcctgcccaagatcctggaggatgggcttcccaagatgccttgcactgtcccagaaacg
gatgtgccccagctcttccgggagccttacatccgcaccggctaccgccccacggggcac
gagtggcgctactacttcttcagcctctttcagaaacacaacgaggtggtcaacgtctgg
acccatttactggcagccctggccgtcctcttgcgattctgggcctttgccgaggctgag
gccttgccatgggcgtctacccactccctgcctctgctcctcttcatcctgtcgtcaatc
acttacctcacctgcagccttctggcccacctgctgcagtccaagtcagagctctcccac
tacaccttctactttgtggactatgttggcgtgagcgtttaccaatatggcagtgctttg
gctcatttcttctacagctctgaccaggcctggtatgaccggttctggcttttcttcttg
ccagcagctgccttctgtggctggttatcttgtgctggctgttgctatgccaaatatcgt
taccggaggccttatccagtcatgaggaagatctgtcaagtggtgccagcaggtctggct
tttatcctagacatcagccctgtggcacaccgtgtggcgctctgtcacctggctggctgc
caggagcaagcagcctggtaccacaccctccagatcctcttcttcctggttagcgcttat
ttcttctcctgccccgtgcctgagaagtacttcccgggttcctgtgacatcgtgggccat
gggcatcagatcttccatgcatttctgtccatctgtacgctctcccagctggaggccatc
ctcctggactaccaggggcggcaggagatcttcctgcagcgccatggacccctatctgtc
cacatggcctgcctctccttcttcttcctggctgcctgcagtgctgccaccgcagccctt
ctgaggcacaaagtcaaggccagactgaccaagaaagattcctga

DBGET integrated database retrieval system