KEGG   Homo sapiens (human): 8643
Entry
8643              CDS       T01001                                 
Symbol
PTCH2, PTC2
Name
(RefSeq) patched 2
  KO
K11101  patched 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
hsa05200  Pathways in cancer
hsa05217  Basal cell carcinoma
Network
nt06217  HH signaling
nt06269  Basal cell carcinoma
nt06501  HH signaling
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00062  Hedgehog signaling pathway
N01538  Hedgehog signaling pathway, PTCH coreceptor
Disease
H00039  Basal cell carcinoma
H00895  Basal cell nevus syndrome
H01667  Medulloblastoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    8643 (PTCH2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    8643 (PTCH2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    8643 (PTCH2)
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 8643
NCBI-ProteinID: NP_003729
OMIM: 603673
HGNC: 9586
Ensembl: ENSG00000117425
Pharos: Q9Y6C5(Tbio)
UniProt: Q9Y6C5
LinkDB
Position
1:complement(44819845..44843253)
AA seq 1203 aa
MTRSPPLRELPPSYTPPARTAAPQILAGSLKAPLWLRAYFQGLLFSLGCGIQRHCGKVLF
LGLLAFGALALGLRMAIIETNLEQLWVEVGSRVSQELHYTKEKLGEEAAYTSQMLIQTAR
QEGENILTPEALGLHLQAALTASKVQVSLYGKSWDLNKICYKSGVPLIENGMIERMIEKL
FPCVILTPLDCFWEGAKLQGGSAYLPGRPDIQWTNLDPEQLLEELGPFASLEGFRELLDK
AQVGQAYVGRPCLHPDDLHCPPSAPNHHSRQAPNVAHELSGGCHGFSHKFMHWQEELLLG
GMARDPQGELLRAEALQSTFLLMSPRQLYEHFRGDYQTHDIGWSEEQASTVLQAWQRRFV
QLAQEALPENASQQIHAFSSTTLDDILHAFSEVSAARVVGGYLLMLAYACVTMLRWDCAQ
SQGSVGLAGVLLVALAVASGLGLCALLGITFNAATTQVLPFLALGIGVDDVFLLAHAFTE
ALPGTPLQERMGECLQRTGTSVVLTSINNMAAFLMAALVPIPALRAFSLQAAIVVGCTFV
AVMLVFPAILSLDLRRRHCQRLDVLCCFSSPCSAQVIQILPQELGDGTVPVGIAHLTATV
QAFTHCEASSQHVVTILPPQAHLVPPPSDPLGSELFSPGGSTRDLLGQEEETRQKAACKS
LPCARWNLAHFARYQFAPLLLQSHAKAIVLVLFGALLGLSLYGATLVQDGLALTDVVPRG
TKEHAFLSAQLRYFSLYEVALVTQGGFDYAHSQRALFDLHQRFSSLKAVLPPPATQAPRT
WLHYYRNWLQGIQAAFDQDWASGRITRHSYRNGSEDGALAYKLLIQTGDAQEPLDFSQLT
TRKLVDREGLIPPELFYMGLTVWVSSDPLGLAASQANFYPPPPEWLHDKYDTTGENLRIP
PAQPLEFAQFPFLLRGLQKTADFVEAIEGARAACAEAGQAGVHAYPSGSPFLFWEQYLGL
RRCFLLAVCILLVCTFLVCALLLLNPWTAGLIVLVLAMMTVELFGIMGFLGIKLSAIPVV
ILVASVGIGVEFTVHVALGFLTTQGSRNLRAAHALEHTFAPVTDGAISTLLGLLMLAGSH
FDFIVRYFFAALTVLTLLGLLHGLVLLPVLLSILGPPPEVIQMYKESPEILSPPAPQGGG
LRWGASSSLPQSFARVTTSMTVAIHPPPLPGAYIHPAPDEPPWSPAATSSGNLSSRGPGP
ATG
NT seq 3612 nt   +upstreamnt  +downstreamnt
atgactcgatcgccgcccctcagagagctgcccccgagttacacacccccagctcgaacc
gcagcaccccagatcctagctgggagcctgaaggctccactctggcttcgtgcttacttc
cagggcctgctcttctctctgggatgcgggatccagagacattgtggcaaagtgctcttt
ctgggactgttggcctttggggccctggcattaggtctccgcatggccattattgagaca
aacttggaacagctctgggtagaagtgggcagccgggtgagccaggagctgcattacacc
aaggagaagctgggggaggaggctgcatacacctctcagatgctgatacagaccgcacgc
caggagggagagaacatcctcacacccgaagcacttggcctccacctccaggcagccctc
actgccagtaaagtccaagtatcactctatgggaagtcctgggatttgaacaaaatctgc
tacaagtcaggagttccccttattgaaaatggaatgattgagcggatgattgagaagctg
tttccgtgcgtgatcctcacccccctcgactgcttctgggagggagccaaactccaaggg
ggctccgcctacctgcccggccgcccggatatccagtggaccaacctggatccagagcag
ctgctggaggagctgggtccctttgcctcccttgagggcttccgggagctgctagacaag
gcacaggtgggccaggcctacgtggggcggccctgtctgcaccctgatgacctccactgc
ccacctagtgcccccaaccatcacagcaggcaggctcccaatgtggctcacgagctgagt
gggggctgccatggcttctcccacaaattcatgcactggcaggaggaattgctgctggga
ggcatggccagagacccccaaggagagctgctgagggcagaggccctgcagagcaccttc
ttgctgatgagtccccgccagctgtacgagcatttccggggtgactatcagacacatgac
attggctggagtgaggagcaggccagcacagtgctacaagcctggcagcggcgctttgtg
cagctggcccaggaggccctgcctgagaacgcttcccagcagatccatgccttctcctcc
accaccctggatgacatcctgcatgcgttctctgaagtcagtgctgcccgtgtggtggga
ggctatctgctcatgctggcctatgcctgtgtgaccatgctgcggtgggactgcgcccag
tcccagggttccgtgggccttgccggggtactgctggtggccctggcggtggcctcaggc
cttgggctctgtgccctgctcggcatcaccttcaatgctgccactacccaggtgctgccc
ttcttggctctgggaatcggcgtggatgacgtattcctgctggcgcatgccttcacagag
gctctgcctggcacccctctccaggagcgcatgggcgagtgtctgcagcgcacgggcacc
agtgtcgtactcacatccatcaacaacatggccgccttcctcatggctgccctcgttccc
atccctgcgctgcgagccttctccctacaggcggccatagtggttggctgcacctttgta
gccgtgatgcttgtcttcccagccatcctcagcctggacctacggcggcgccactgccag
cgccttgatgtgctctgctgcttctccagtccctgctctgctcaggtgattcagatcctg
ccccaggagctgggggacgggacagtaccagtgggcattgcccacctcactgccacagtt
caagcctttacccactgtgaagccagcagccagcatgtggtcaccatcctgcctccccaa
gcccacctggtgcccccaccttctgacccactgggctctgagctcttcagccctggaggg
tccacacgggaccttctaggccaggaggaggagacaaggcagaaggcagcctgcaagtcc
ctgccctgtgcccgctggaatcttgcccatttcgcccgctatcagtttgccccgttgctg
ctccagtcacatgctaaggccatcgtgctggtgctctttggtgctcttctgggcctgagc
ctctacggagccaccttggtgcaagacggcctggccctgacggatgtggtgcctcggggc
accaaggagcatgccttcctgagcgcccagctcaggtacttctccctgtacgaggtggcc
ctggtgacccagggtggctttgactacgcccactcccaacgcgccctctttgatctgcac
cagcgcttcagttccctcaaggcggtgctgcccccaccggccacccaggcaccccgcacc
tggctgcactattaccgcaactggctacagggaatccaggctgcctttgaccaggactgg
gcttctgggcgcatcacccgccactcgtaccgcaatggctctgaggatggggccctggcc
tacaagctgctcatccagactggagacgcccaggagcctctggatttcagccagctgacc
acaaggaagctggtggacagagagggactgattccacccgagctcttctacatggggctg
accgtgtgggtgagcagtgaccccctgggtctggcagcctcacaggccaacttctacccc
ccacctcctgaatggctgcacgacaaatacgacaccacgggggagaaccttcgcatcccg
ccagctcagcccttggagtttgcccagttccccttcctgctgcgtggcctccagaagact
gcagactttgtggaggccatcgagggggcccgggcagcatgcgcagaggccggccaggct
ggggtgcacgcctaccccagcggctcccccttcctcttctgggaacagtatctgggcctg
cggcgctgcttcctgctggccgtctgcatcctgctggtgtgcactttcctcgtctgtgct
ctgctgctcctcaacccctggacggctggcctcatagtgctggtcctggcgatgatgaca
gtggaactctttggtatcatgggtttcctgggcatcaagctgagtgccatccccgtggtg
atccttgtggcctctgtaggcattggcgttgagttcacagtccacgtggctctgggcttc
ctgaccacccagggcagccggaacctgcgggccgcccatgcccttgagcacacatttgcc
cccgtgaccgatggggccatctccacattgctgggtctgctcatgcttgctggttcccac
tttgacttcattgtaaggtacttctttgcggcgctgacagtgctcacgctcctgggcctc
ctccatggactcgtgctgctgcctgtgctgctgtccatcctgggcccgccgccagaggtg
atacagatgtacaaggaaagcccagagatcctgagtccaccagctccacagggaggcggg
cttaggtggggggcatcctcctccctgccccagagctttgccagagtgactacctccatg
accgtggccatccacccaccccccctgcctggtgcctacatccatccagcccctgatgag
cccccttggtcccctgctgccactagctctggcaacctcagttccaggggaccaggtcca
gccactgggtga

DBGET integrated database retrieval system