KEGG   Homo sapiens (human): 8807
Entry
8807              CDS       T01001                                 
Symbol
IL18RAP, ACPL, CD218b, CDw218b, IL-18R-beta, IL-18RAcP, IL-18Rbeta, IL-1R-7, IL-1R7, IL-1RAcPL, IL18RB
Name
(RefSeq) interleukin 18 receptor accessory protein
  KO
K05174  interleukin 18 receptor accessory protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa05321  Inflammatory bowel disease
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01269  IL18/37 to IL18R signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8807 (IL18RAP)
   04061 Viral protein interaction with cytokine and cytokine receptor
    8807 (IL18RAP)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    8807 (IL18RAP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    8807 (IL18RAP)
   04090 CD molecules [BR:hsa04090]
    8807 (IL18RAP)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL1 receptor family
   8807 (IL18RAP)
CD molecules [BR:hsa04090]
 Proteins
  8807 (IL18RAP)
SSDB
Motif
Pfam: Ig_6 TIR Ig_2 Ig_3 ig I-set Ig_4 TIR_2 Ig_5
Other DBs
NCBI-GeneID: 8807
NCBI-ProteinID: NP_003844
OMIM: 604509
HGNC: 5989
Ensembl: ENSG00000115607
Vega: OTTHUMG00000130777
Pharos: O95256(Tbio)
UniProt: O95256
Structure
LinkDB
Position
2:102418621..102452565
AA seq 599 aa
MLCLGWIFLWLVAGERIKGFNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRN
RLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVNN
SGSYICRPKMIKSPYDVACCVKMILEVKPQTNASCEYSASHKQDLLLGSTGSISCPSLSC
QSDAQSPAVTWYKNGKLLSVERSNRIVVDEVYDYHQGTYVCDYTQSDTVSSWTVRAVVQV
RTIVGDTKLKPDILDPVEDTLEVELGKPLTISCKARFGFERVFNPVIKWYIKDSDLEWEV
SVPEAKSIKSTLKDEIIERNIILEKVTQRDLRRKFVCFVQNSIGNTTQSVQLKEKRGVVL
LYILLGTIGTLVAVLAASALLYRHWIEIVLLYRTYQSKDQTLGDKKDFDAFVSYAKWSSF
PSEATSSLSEEHLALSLFPDVLENKYGYSLCLLERDVAPGGVYAEDIVSIIKRSRRGIFI
LSPNYVNGPSIFELQAAVNLALDDQTLKLILIKFCYFQEPESLPHLVKKALRVLPTVTWR
GLKSVPPNSRFWAKMRYHMPVKNSQGFTWNQLRITSRIFQWKGLSRTETTGRSSQPKEW
NT seq 1800 nt   +upstreamnt  +downstreamnt
atgctctgtttgggctggatatttctttggcttgttgcaggagagcgaattaaaggattt
aatatttcaggttgttccacaaaaaaactcctttggacatattctacaaggagtgaagag
gaatttgtcttattttgtgatttaccagagccacagaaatcacatttctgccacagaaat
cgactctcaccaaaacaagtccctgagcacctgcccttcatgggtagtaacgacctatct
gatgtccaatggtaccaacaaccttcgaatggagatccattagaggacattaggaaaagc
tatcctcacatcattcaggacaaatgtacccttcactttttgaccccaggggtgaataat
tctgggtcatatatttgtagacccaagatgattaagagcccctatgatgtagcctgttgt
gtcaagatgattttagaagttaagccccagacaaatgcatcctgtgagtattccgcatca
cataagcaagacctacttcttgggagcactggctctatttcttgccccagtctcagctgc
caaagtgatgcacaaagtccagcggtaacctggtacaagaatggaaaactcctctctgtg
gaaaggagcaaccgaatcgtagtggatgaagtttatgactatcaccagggcacatatgta
tgtgattacactcagtcggatactgtgagttcgtggacagtcagagctgttgttcaagtg
agaaccattgtgggagacactaaactcaaaccagatattctggatcctgtcgaggacaca
ctggaagtagaacttggaaagcctttaactattagctgcaaagcacgatttggctttgaa
agggtctttaaccctgtcataaaatggtacatcaaagattctgacctagagtgggaagtc
tcagtacctgaggcgaaaagtattaaatccactttaaaggatgaaatcattgagcgtaat
atcatcttggaaaaagtcactcagcgtgatcttcgcaggaagtttgtttgctttgtccag
aactccattggaaacacaacccagtccgtccaactgaaagaaaagagaggagtggtgctc
ctgtacatcctgcttggcaccatcgggaccctggtggccgtgctggcggcgagtgccctc
ctctacaggcactggattgaaatagtgctgctgtaccggacctaccagagcaaggatcag
acgcttggggataaaaaggattttgatgctttcgtatcctatgcaaaatggagctctttt
ccaagtgaggccacttcatctctgagtgaagaacacttggccctgagcctatttcctgat
gttttagaaaacaaatatggatatagcctgtgtttgcttgaaagagatgtggctccagga
ggagtgtatgcagaagacattgtgagcattattaagagaagcagaagaggaatatttatc
ttgagccccaactatgtcaatggacccagtatctttgaactacaagcagcagtgaatctt
gccttggatgatcaaacactgaaactcattttaattaagttctgttacttccaagagcca
gagtctctacctcatctcgtgaaaaaagctctcagggttttgcccacagttacttggaga
ggcttaaaatcagttcctcccaattctaggttctgggccaaaatgcgctaccacatgcct
gtgaaaaactctcagggattcacgtggaaccagctcagaattacctctaggatttttcag
tggaaaggactcagtagaacagaaaccactgggaggagctcccagcctaaggaatggtga

KEGG   Homo sapiens (human): 8809
Entry
8809              CDS       T01001                                 
Symbol
IL18R1, CD218a, CDw218a, IL-18R-alpha, IL-18Ralpha, IL-1Rrp, IL18RA, IL18Ralpha2, IL1RRP
Name
(RefSeq) interleukin 18 receptor 1
  KO
K05173  interleukin 18 receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04668  TNF signaling pathway
hsa05321  Inflammatory bowel disease
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01269  IL18/37 to IL18R signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    8809 (IL18R1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    8809 (IL18R1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    8809 (IL18R1)
 09160 Human Diseases
  09163 Immune disease
   05321 Inflammatory bowel disease
    8809 (IL18R1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    8809 (IL18R1)
   04090 CD molecules [BR:hsa04090]
    8809 (IL18R1)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL1 receptor family
   8809 (IL18R1)
CD molecules [BR:hsa04090]
 Proteins
  8809 (IL18R1)
SSDB
Motif
Pfam: TIR V-set Ig_2 TIR_2 Ig_3 I-set Ig_6 Ig_5
Other DBs
NCBI-GeneID: 8809
NCBI-ProteinID: NP_003846
OMIM: 604494
HGNC: 5988
Ensembl: ENSG00000115604
Vega: OTTHUMG00000130780
Pharos: Q13478(Tbio)
UniProt: Q13478
Structure
LinkDB
Position
2:102355796..102398776
AA seq 541 aa
MNCRELPLTLWVLISVSTAESCTSRPHITVVEGEPFYLKHCSCSLAHEIETTTKSWYKSS
GSQEHVELNPRSSSRIALHDCVLEFWPVELNDTGSYFFQMKNYTQKWKLNVIRRNKHSCF
TERQVTSKIVEVKKFFQITCENSYYQTLVNSTSLYKNCKKLLLENNKNPTIKKNAEFEDQ
GYYSCVHFLHHNGKLFNITKTFNITIVEDRSNIVPVLLGPKLNHVAVELGKNVRLNCSAL
LNEEDVIYWMFGEENGSDPNIHEEKEMRIMTPEGKWHASKVLRIENIGESNLNVLYNCTV
ASTGGTDTKSFILVRKADMADIPGHVFTRGMIIAVLILVAVVCLVTVCVIYRVDLVLFYR
HLTRRDETLTDGKTYDAFVSYLKECRPENGEEHTFAVEILPRVLEKHFGYKLCIFERDVV
PGGAVVDEIHSLIEKSRRLIIVLSKSYMSNEVRYELESGLHEALVERKIKIILIEFTPVT
DFTFLPQSLKLLKSHRVLKWKADKSLSYNSRFWKNLLYLMPAKTVKPGRDEPEVLPVLSE
S
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgaattgtagagaattacccttgaccctttgggtgcttatatctgtaagcactgcagaa
tcttgtacttcacgtccccacattactgtggttgaaggggaacctttctatctgaaacat
tgctcgtgttcacttgcacatgagattgaaacaaccaccaaaagctggtacaaaagcagt
ggatcacaggaacatgtggagctgaacccaaggagttcctcgagaattgctttgcatgat
tgtgttttggagttttggccagttgagttgaatgacacaggatcttactttttccaaatg
aaaaattatactcagaaatggaaattaaatgtcatcagaagaaataaacacagctgtttc
actgaaagacaagtaactagtaaaattgtggaagttaaaaaattttttcagataacctgt
gaaaacagttactatcaaacactggtcaacagcacatcattgtataagaactgtaaaaag
ctactactggagaacaataaaaacccaacgataaagaagaacgccgagtttgaagatcag
gggtattactcctgcgtgcatttccttcatcataatggaaaactatttaatatcaccaaa
accttcaatataacaatagtggaagatcgcagtaatatagttccggttcttcttggacca
aagcttaaccatgttgcagtggaattaggaaaaaacgtaaggctcaactgctctgctttg
ctgaatgaagaggatgtaatttattggatgttcggggaagaaaatggatcggatcctaat
atacatgaagagaaagaaatgagaattatgactccagaaggcaaatggcatgcttcaaaa
gtattgagaattgaaaatattggtgaaagcaatctaaatgttttatataattgcactgtg
gccagcacgggaggcacagacaccaaaagcttcatcttggtgagaaaagcagacatggct
gatatcccaggccacgtcttcacaagaggaatgatcatagctgttttgatcttggtggca
gtagtgtgcctagtgactgtgtgtgtcatttatagagttgacttggttctattttataga
catttaacgagaagagatgaaacattaacagatggaaaaacatatgatgcttttgtgtct
tacctaaaagaatgccgacctgaaaatggagaggagcacacctttgctgtggagattttg
cccagggtgttggagaaacattttgggtataagttatgcatatttgaaagggatgtagtg
cctggaggagctgttgttgatgaaatccactcactgatagagaaaagccgaagactaatc
attgtcctaagtaaaagttatatgtctaatgaggtcaggtatgaacttgaaagtggactc
catgaagcattggtggaaagaaaaattaaaataatcttaattgaatttacacctgttact
gacttcacattcttgccccaatcactaaagcttttgaaatctcacagagttctgaagtgg
aaggccgataaatctctttcttataactcaaggttctggaagaaccttctttacttaatg
cctgcaaaaacagtcaagccaggtagagacgaaccggaagtcttgcctgttctttccgag
tcttaa

DBGET integrated database retrieval system