KEGG   Homo sapiens (human): 929Help
Entry
929               CDS       T01001                                 

Gene name
CD14
Definition
(RefSeq) CD14 molecule
  KO
K04391  monocyte differentiation antigen CD14
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04145  Phagosome
hsa04620  Toll-like receptor signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Network
N00112  AML1-ETO fusion to PU.1-mediated transcription
Disease
H00079  Asthma
H01360  Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    929 (CD14)
   04064 NF-kappa B signaling pathway
    929 (CD14)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    929 (CD14)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    929 (CD14)
   04620 Toll-like receptor signaling pathway
    929 (CD14)
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    929 (CD14)
  09162 Cancers: Specific types
   05221 Acute myeloid leukemia
    929 (CD14)
  09171 Infectious diseases: Bacterial
   05130 Pathogenic Escherichia coli infection
    929 (CD14)
   05132 Salmonella infection
    929 (CD14)
   05133 Pertussis
    929 (CD14)
   05134 Legionellosis
    929 (CD14)
   05152 Tuberculosis
    929 (CD14)
  09174 Infectious diseases: Parasitic
   05146 Amoebiasis
    929 (CD14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    929 (CD14)
   04090 CD molecules [BR:hsa04090]
    929 (CD14)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    929 (CD14)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   929 (CD14)
CD molecules [BR:hsa04090]
 Proteins
  929 (CD14)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Receptors
  929 (CD14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_8 LRR_6
Motif
Other DBs
NCBI-GeneID: 929
NCBI-ProteinID: NP_000582
OMIM: 158120
HGNC: 1628
Ensembl: ENSG00000170458
Vega: OTTHUMG00000129507
Pharos: P08571(Tbio)
UniProt: P08571
LinkDB All DBs
Structure
PDB: 

Position
5q31.3
AA seq 375 aa AA seqDB search
MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIH
AGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKE
LTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQA
HSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGV
CAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLR
VLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVG
VSGTLVLLQGARGFA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgcgtcctgcttgttgctgctgctgctgccgctggtgcacgtctctgcgacc
acgccagaaccttgtgagctggacgatgaagatttccgctgcgtctgcaacttctccgaa
cctcagcccgactggtccgaagccttccagtgtgtgtctgcagtagaggtggagatccat
gccggcggtctcaacctagagccgtttctaaagcgcgtcgatgcggacgccgacccgcgg
cagtatgctgacacggtcaaggctctccgcgtgcggcggctcacagtgggagccgcacag
gttcctgctcagctactggtaggcgccctgcgtgtgctagcgtactcccgcctcaaggaa
ctgacgctcgaggacctaaagataaccggcaccatgcctccgctgcctctggaagccaca
ggacttgcactttccagcttgcgcctacgcaacgtgtcgtgggcgacagggcgttcttgg
ctcgccgagctgcagcagtggctcaagccaggcctcaaggtactgagcattgcccaagca
cactcgcctgccttttcctgcgaacaggttcgcgccttcccggcccttaccagcctagac
ctgtctgacaatcctggactgggcgaacgcggactgatggcggctctctgtccccacaag
ttcccggccatccagaatctagcgctgcgcaacacaggaatggagacgcccacaggcgtg
tgcgccgcactggcggcggcaggtgtgcagccccacagcctagacctcagccacaactcg
ctgcgcgccaccgtaaaccctagcgctccgagatgcatgtggtccagcgccctgaactcc
ctcaatctgtcgttcgctgggctggaacaggtgcctaaaggactgccagccaagctcaga
gtgctcgatctcagctgcaacagactgaacagggcgccgcagcctgacgagctgcccgag
gtggataacctgacactggacgggaatcccttcctggtccctggaactgccctcccccac
gagggctcaatgaactccggcgtggtcccagcctgtgcacgttcgaccctgtcggtgggg
gtgtcgggaaccctggtgctgctccaaggggcccggggctttgcctaa

DBGET integrated database retrieval system