KEGG   Homo sapiens (human): 93978
Entry
93978             CDS       T01001                                 
Symbol
CLEC6A, CLEC4N, CLECSF10, dectin-2, hDECTIN-2
Name
(RefSeq) C-type lectin domain containing 6A
  KO
K17514  C-type lectin domain family 6 member A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    93978 (CLEC6A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    93978 (CLEC6A)
   04091 Lectins [BR:hsa04091]
    93978 (CLEC6A)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   93978 (CLEC6A)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   Macrophage receptos
    93978 (CLEC6A)
SSDB
Motif
Pfam: Lectin_C
Other DBs
NCBI-GeneID: 93978
NCBI-ProteinID: NP_001007034
OMIM: 613579
HGNC: 14556
Ensembl: ENSG00000205846
Pharos: Q6EIG7(Tbio)
UniProt: Q6EIG7
Structure
LinkDB
Position
12:8455962..8478330
AA seq 209 aa
MMQEQQPQSTEKRGWLSLRLWSVAGISIALLSACFIVSCVVTYHFTYGETGKRLSELHSY
HSSLTCFSEGTKVPAWGCCPASWKSFGSSCYFISSEEKVWSKSEQNCVEMGAHLVVFNTE
AEQNFIVQQLNESFSYFLGLSDPQGNNNWQWIDKTPYEKNVRFWHLGEPNHSAEQCASIV
FWKPTGWGWNDVICETRRNSICEMNKIYL
NT seq 630 nt   +upstreamnt  +downstreamnt
atgatgcaagagcagcaacctcaaagtacagagaaaagaggctggttgtccctgagactc
tggtctgtggctgggatttccattgcactcctcagtgcttgcttcattgtgagctgtgta
gtaacttaccattttacatatggtgaaactggcaaaaggctgtctgaactacactcatat
cattcaagtctcacctgcttcagtgaagggacaaaggtgccagcctggggatgttgccca
gcttcttggaagtcatttggttccagttgctacttcatttccagtgaagagaaggtttgg
tctaagagtgagcagaactgtgttgagatgggagcacatttggttgtgttcaacacagaa
gcagagcagaatttcattgtccagcagctgaatgagtcattttcttattttctggggctt
tcagacccacaaggtaataataattggcaatggattgataagacaccttatgagaaaaat
gtcagattttggcacctaggtgagcccaatcattctgcagagcaatgtgcttcaatagtc
ttctggaaacctacaggatggggctggaatgatgttatctgtgaaactagaaggaattca
atatgtgagatgaataagatttacctatga

DBGET integrated database retrieval system