KEGG   Homo sapiens (human): 9454
Entry
9454              CDS       T01001                                 
Symbol
HOMER3, HOMER-3, VESL3
Name
(RefSeq) homer scaffold protein 3
  KO
K15010  homer
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    9454 (HOMER3)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    9454 (HOMER3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    9454 (HOMER3)
Cilium and associated proteins [BR:hsa03037]
 Other cilia and associated proteins
  Stereociliary proteins
   9454 (HOMER3)
SSDB
Motif
Pfam: WH1 Sec66 MerR-DNA-bind ATG16 bZIP_2 AAA_13 DUF4407 Allexi_40kDa Phage_GP20 DUF4201
Other DBs
NCBI-GeneID: 9454
NCBI-ProteinID: NP_001139194
OMIM: 604800
HGNC: 17514
Ensembl: ENSG00000051128
Vega: OTTHUMG00000182995
Pharos: Q9NSC5(Tbio)
UniProt: Q9NSC5
Structure
LinkDB
Position
19:complement(18929201..18941217)
AA seq 361 aa
MSTAREQPIFSTRAHVFQIDPATKRNWIPAGKHALTVSYFYDATRNVYRIISIGGAKAII
NSTVTPNMTFTKTSQKFGQWADSRANTVYGLGFASEQHLTQFAEKFQEVKEAARLAREKS
QDGGELTSPALGLASHQVPPSPLVSANGPGEEKLFRSQSADAPGPTERERLKKMLSEGSV
GEVQWEAEFFALQDSNNKLAGALREANAAAAQWRQQLEAQRAEAERLRQRVAELEAQAAS
EVTPTGEKEGLGQGQSLEQLEALVQTKDQEIQTLKSQTGGPREALEAAEREETQQKVQDL
ETRNAELEHQLRAMERSLEEARAERERARAEVGRAAQLLDVSLFELSELREGLARLAEAA
P
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgtccacagccagggagcagccaatcttcagcacacgggcgcacgtgttccaaattgac
ccagccaccaagcgaaactggatcccagcgggcaagcacgcactcactgtctcctatttc
tacgatgccacccgcaatgtgtaccgcatcatcagcatcggaggcgccaaggccatcatc
aacagcactgtcactcccaacatgaccttcaccaaaacttcccagaagttcgggcagtgg
gccgacagtcgcgccaacacagtctacggcctgggctttgcctctgaacagcatctgaca
cagtttgccgagaagttccaggaagtgaaggaagcagccaggctggccagggagaaatct
caggatggcggggagctcaccagtccagccctggggctcgcctcccaccaggtgcccccg
agccctctcgtcagtgccaacggccccggcgaggaaaaactgttccgcagccagagcgct
gatgcccccggccccacagagcgcgagcggctaaagaagatgttgtctgagggctccgtg
ggcgaggtacagtgggaggccgagtttttcgcactgcaggacagcaacaacaagctggca
ggcgccctgcgagaggccaacgccgccgcagcccagtggaggcagcagctggaggctcag
cgtgcagaggccgagcggctgcggcagcgggtggctgagctggaggctcaggcagcttca
gaggtgacccccaccggtgagaaggaggggctgggccagggccagtcgctggaacagctg
gaagctctggtgcaaaccaaggaccaggagattcagaccctgaagagtcagactgggggg
ccccgcgaggccctggaggctgccgagcgtgaggagactcagcagaaggtgcaggacctg
gagacccgcaatgcggagttggagcaccagctgcgggcgatggagcgcagcctggaggag
gcacgggcagagcgggagcgggcgcgggctgaggtgggccgggcagcgcagctgctggac
gtcagcctgtttgagctgagtgagctgcgtgagggcctggcccgcctggctgaggctgcg
ccctga

KEGG   Homo sapiens (human): 9455
Entry
9455              CDS       T01001                                 
Symbol
HOMER2, ACPD, CPD, DFNA68, HOMER-2, VESL-2
Name
(RefSeq) homer scaffold protein 2
  KO
K15010  homer
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04724  Glutamatergic synapse
Disease
H00604  Deafness, autosomal dominant
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    9455 (HOMER2)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    9455 (HOMER2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    9455 (HOMER2)
Cilium and associated proteins [BR:hsa03037]
 Other cilia and associated proteins
  Stereociliary proteins
   9455 (HOMER2)
SSDB
Motif
Pfam: WH1 Macoilin MAD CENP-F_leu_zip CCDC22 SYCE1 DMPK_coil Phage_GP20 GAS Uso1_p115_C Crescentin CortBP2 Fez1 CLZ FPP TMF_TATA_bd
Other DBs
NCBI-GeneID: 9455
NCBI-ProteinID: NP_955362
OMIM: 604799
HGNC: 17513
Ensembl: ENSG00000103942
Vega: OTTHUMG00000172462
Pharos: Q9NSB8(Tbio)
UniProt: Q9NSB8
LinkDB
Position
15:complement(82834661..82986157)
AA seq 354 aa
MGEQPIFTTRAHVFQIDPNTKKNWMPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINST
ITPNMTFTKTSQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVKEAAKIAKDKTQEK
IETSSNHSQESGRETPSSTQASSVNGTDDEKASHAGPANTHLKSENDKLKIALTQSAANV
KKWEIELQTLRESNARLTTALQESAASVEQWKRQFSICRDENDRLRNKIDELEEQCSEIN
REKEKNTQLKRRIEELEAELREKETELKDLRKQSEIIPQLMSECEYVSEKLEAAERDNQN
LEDKVRSLKTDIEESKYRQRHLKVELKSFLEVLDGKIDDLHDFRRGLSKLGTDN
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggagaacagcccatcttcaccacccgagcgcatgtcttccagattgaccccaacacc
aagaagaactggatgcctgcgagcaagcaggcggtcaccgtttcctacttctatgatgtc
acaaggaacagctatcggatcatcagtgtggacggagccaaggtgatcataaacagcaca
atcacaccgaatatgaccttcaccaaaacgtcacagaagtttgggcagtgggccgacagc
agagccaacacagtgtttggtttggggttttcctctgagcagcagctgacaaagtttgca
gagaaattccaggaggtgaaagaagctgccaagatagccaaagacaagacgcaggagaaa
atcgagacctcaagtaatcattcccaagaatctgggcgtgaaaccccatcttctactcag
gcatccagtgtcaacgggacggacgatgaaaaggcctctcacgccggtccagccaacaca
cacctgaagtctgagaatgacaagctgaagattgccttgacgcagagcgcagccaacgtg
aagaagtgggagatcgagctgcagacccttcgggagagcaatgcacggctgaccacagca
ctgcaggagtcggcagccagtgtggagcagtggaagaggcagttctccatctgccgtgat
gagaatgaccggctccgcaacaagattgatgagctggaagaacaatgcagtgagatcaac
agagagaaggagaagaacacgcagctgaagaggaggatcgaggagctggaggcagagctc
cgagaaaaggagacagagctgaaagatctccgaaaacaaagtgaaatcatacctcagctc
atgtcagagtgcgaatatgtctctgagaagctagaggcggcagagagagacaatcaaaac
ctggaagacaaagtgcgttccttaaagacagacattgaggagagcaaataccgacagcgc
cacctgaaggtggagttgaagagcttcctggaggtgctggacgggaagattgacgacctg
catgacttccgccgagggctctccaagctgggcaccgataactag

KEGG   Homo sapiens (human): 9456
Entry
9456              CDS       T01001                                 
Symbol
HOMER1, HOMER, HOMER1A, HOMER1B, HOMER1C, SYN47, Ves-1
Name
(RefSeq) homer scaffold protein 1
  KO
K15010  homer
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    9456 (HOMER1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    9456 (HOMER1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    9456 (HOMER1)
Cilium and associated proteins [BR:hsa03037]
 Other cilia and associated proteins
  Stereociliary proteins
   9456 (HOMER1)
SSDB
Motif
Pfam: WH1 GAS EzrA HMMR_N Crescentin BLOC1_2 FUSC ATG16 FAP206 DUF1465 NPV_P10 APG6_N Nuf2_DHR10-like CENP-K
Other DBs
NCBI-GeneID: 9456
NCBI-ProteinID: NP_004263
OMIM: 604798
HGNC: 17512
Ensembl: ENSG00000152413
Vega: OTTHUMG00000134278
Pharos: Q86YM7(Tbio)
UniProt: Q86YM7 Q5U5K4
LinkDB
Position
5:complement(79372636..79514134)
AA seq 354 aa
MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINST
ITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEK
MELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSEPRAEPTQNALPFSHSSAIS
KHWEAELATLKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHKRVTELECVSSQAN
AVHTHKTELNQTIQELEETLKLKEEEIERLKQEIDNARELQEQRDSLTQKLQEVEIRNKD
LEGQLSDLEQRLEKSQNEQEAFRNNLKTLLEILDGKIFELTELRDNLAKLLECS
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggggaacaacctatcttcagcactcgagctcatgtcttccaaattgacccaaacaca
aagaagaactgggtacccaccagcaagcatgcagttactgtgtcttatttctatgacagc
acaagaaatgtgtataggataatcagtttagatggctcaaaggcaataataaatagtacc
atcaccccaaacatgacatttactaaaacatctcagaagtttggccagtgggctgatagc
cgggcaaacaccgtttatggattgggattctcctctgagcatcatctttcgaaatttgca
gaaaagtttcaggaatttaaagaagctgctcgactagcaaaggaaaaatcacaagagaag
atggaacttaccagtacaccttcacaggaatccgcaggcggggatcttcagtctccttta
acaccggaaagtatcaacgggacagatgatgaaagaacacctgatgtgacacagaactca
gagccaagggctgaaccaactcagaatgcattgccattttcacatagttcagcaatcagc
aaacattgggaggctgaactggctaccctcaaaggaaataatgccaaactcactgcagcc
ctgctggagtccactgccaatgtgaaacaatggaaacagcaacttgctgcctatcaagag
gaagcagaacgtctgcacaagcgggtgactgaacttgaatgtgttagtagccaagcaaat
gcagtacatactcataagacagaattaaatcagacaatacaagaactggaagagacactg
aaactgaaggaagaggaaatagaaaggttaaaacaagaaattgataatgccagagaacta
caagaacagagggattctttgactcagaaactacaggaagtagaaattcggaacaaagac
ctggagggacaactgtctgacttagagcaacgtctggagaaaagtcagaatgaacaagaa
gcttttcgcaataacctgaagacactcttagaaattctggatggaaagatatttgaacta
acagaattacgagataacttggccaagctactagaatgcagctaa

DBGET integrated database retrieval system