KEGG   Homo sapiens (human): 9572
Entry
9572              CDS       T01001                                 
Symbol
NR1D1, EAR1, REVERBA, REVERBalpha, THRA1, THRAL, ear-1, hRev
Name
(RefSeq) nuclear receptor subfamily 1 group D member 1
  KO
K03728  nuclear receptor subfamily 1 group D member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    9572 (NR1D1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    9572 (NR1D1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    9572 (NR1D1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    9572 (NR1D1)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1D. Rev-Erb
   9572 (NR1D1)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 9572
NCBI-ProteinID: NP_068370
OMIM: 602408
HGNC: 7962
Ensembl: ENSG00000126368
Pharos: P20393(Tchem)
UniProt: P20393 F1D8S3
Structure
LinkDB
Position
17:complement(40092793..40100589)
AA seq 614 aa
MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDNSNGSFQSLTQGCPTYFPPSPTGSL
TQDPARSFGSIPPSLSDDGSPSSSSSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKSTS
NITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIVRI
NRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQSAMNLANNQLSSQCPLETS
PTQHPTPGPMGPSPPPAPVPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIF
TYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNTLAAQRHNEALNGLRQ
APSSYPPTWPPGPAHHSCHQSNSNGHRLCPTHVYAAPEGKAPANSPRQGNSKNVLLACPM
NMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFEVL
MVRFASLFNVKDQTVMFLSRTTYSLQELGAMGMGDLLSAMFDFSEKLNSLALTEEELGLF
TAVVLVSADRSGMENSASVEQLQETLLRALRALVLKNRPLETSRFTKLLLKLPDLRTLNN
MHSEKLLSFRVDAQ
NT seq 1845 nt   +upstreamnt  +downstreamnt
atgacgaccctggactccaacaacaacacaggtggcgtcatcacctacattggctccagt
ggctcctccccaagccgcaccagccctgaatccctctatagtgacaactccaatggcagc
ttccagtccctgacccaaggctgtcccacctacttcccaccatcccccactggctccctc
acccaagacccggctcgctcctttgggagcattccacccagcctgagtgatgacggctcc
ccttcttcctcatcttcctcgtcgtcatcctcctcctccttctataatgggagcccccct
gggagtctacaagtggccatggaggacagcagccgagtgtcccccagcaagagcaccagc
aacatcaccaagctgaatggcatggtgttactgtgtaaagtgtgtggggacgttgcctcg
ggcttccactacggtgtgcacgcctgcgagggctgcaagggctttttccgtcggagcatc
cagcagaacatccagtacaaaaggtgtctgaagaatgagaattgctccatcgtccgcatc
aatcgcaaccgctgccagcaatgtcgcttcaagaagtgtctctctgtgggcatgtctcga
gacgctgtgcgttttgggcgcatccccaaacgagagaagcagcggatgcttgctgagatg
cagagtgccatgaacctggccaacaaccagttgagcagccagtgcccgctggagacttca
cccacccagcaccccaccccaggccccatgggcccctcgccaccccctgctccggtcccc
tcacccctggtgggcttctcccagtttccacaacagctgacgcctcccagatccccaagc
cctgagcccacagtggaggatgtgatatcccaggtggcccgggcccatcgagagatcttc
acctacgcccatgacaagctgggcagctcacctggcaacttcaatgccaaccatgcatca
ggtagccctccagccaccaccccacatcgctgggaaaatcagggctgcccacctgccccc
aatgacaacaacaccttggctgcccagcgtcataacgaggccctaaatggtctgcgccag
gctccctcctcctaccctcccacctggcctcctggccctgcacaccacagctgccaccag
tccaacagcaacgggcaccgtctatgccccacccacgtgtatgcagccccagaaggcaag
gcacctgccaacagtccccggcagggcaactcaaagaatgttctgctggcatgtcctatg
aacatgtacccgcatggacgcagtgggcgaacggtgcaggagatctgggaggatttctcc
atgagcttcacgcccgctgtgcgggaggtggtagagtttgccaaacacatcccgggcttc
cgtgacctttctcagcatgaccaagtcaccctgcttaaggctggcacctttgaggtgctg
atggtgcgctttgcttcgttgttcaacgtgaaggaccagacagtgatgttcctaagccgc
accacctacagcctgcaggagcttggtgccatgggcatgggagacctgctcagtgccatg
ttcgacttcagcgagaagctcaactccctggcgcttaccgaggaggagctgggcctcttc
accgcggtggtgcttgtctctgcagaccgctcgggcatggagaattccgcttcggtggag
cagctccaggagacgctgctgcgggctcttcgggctctggtgctgaagaaccggcccttg
gagacttcccgcttcaccaagctgctgctcaagctgccggacctgcggaccctgaacaac
atgcattccgagaagctgctgtccttccgggtggacgcccagtga

KEGG   Homo sapiens (human): 9975
Entry
9975              CDS       T01001                                 
Symbol
NR1D2, BD73, EAR-1R, REVERBB, REVERBbeta, RVR
Name
(RefSeq) nuclear receptor subfamily 1 group D member 2
  KO
K08531  nuclear receptor subfamily 1 group D member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    9975 (NR1D2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    9975 (NR1D2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    9975 (NR1D2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    9975 (NR1D2)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1D. Rev-Erb
   9975 (NR1D2)
SSDB
Motif
Pfam: zf-C4 Hormone_recep LpxD
Other DBs
NCBI-GeneID: 9975
NCBI-ProteinID: NP_005117
OMIM: 602304
HGNC: 7963
Ensembl: ENSG00000174738
Pharos: Q14995(Tbio)
UniProt: Q14995 F1D8P2
Structure
LinkDB
Position
3:23945286..23980617
AA seq 579 aa
MEVNAGGVIAYISSSSSASSPASCHSEGSENSFQSSSSSVPSSPNSSNSDTNGNPKNGDL
ANIEGILKNDRIDCSMKTSKSSAPGMTKSHSGVTKFSGMVLLCKVCGDVASGFHYGVHAC
EGCKGFFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIP
KREKQRMLIEMQSAMKTMMNSQFSGHLQNDTLVEHHEQTALPAQEQLRPKPQLEQENIKS
SSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPQRGERIPKNMEQYNLNHDH
CGNGLSSHFPCSESQQHLNGQFKGRNIMHYPNGHAICIANGHCMNFSNAYTQRVCDRVPI
DGFSQNENKNSYLCNTGGRMHLVCPMSKSPYVDPHKSGHEIWEEFSMSFTPAVKEVVEFA
KRIPGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAG
DLLNSMFEFSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLI
MKNHPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP
NT seq 1740 nt   +upstreamnt  +downstreamnt
atggaggtgaatgcaggaggtgtgattgcctatatcagttcttccagctcagcctcaagc
cctgcctcttgtcacagtgagggttctgagaatagtttccagtcctcctcctcttctgtt
ccatcttctccaaatagctctaattctgataccaatggtaatcccaagaatggtgatctc
gccaatattgaaggcatcttgaagaatgatcgaatagattgttctatgaaaacaagcaaa
tcgagtgcacctgggatgacaaaaagtcatagtggtgtgacaaaatttagtggcatggtt
ctactgtgtaaagtctgtggggatgtggcgtcaggattccactatggagttcatgcttgc
gaaggctgtaagggtttctttcggagaagtattcaacaaaacatccagtacaagaagtgc
ctgaagaatgaaaactgttctataatgagaatgaataggaacagatgtcagcaatgtcgc
ttcaaaaagtgtctgtctgttggaatgtcaagagatgctgttcggtttggtcgtattcct
aagcgtgaaaaacagaggatgctaattgaaatgcaaagtgcaatgaagaccatgatgaac
agccagttcagtggtcacttgcaaaatgacacattagtagaacatcatgaacagacagcc
ttgccagcccaggaacagctgcgacccaagccccaactggagcaagaaaacatcaaaagc
tcttctcctccatcttctgattttgcaaaggaagaagtgattggcatggtgaccagagct
cacaaggatacctttatgtataatcaagagcagcaagaaaactcagctgagagcatgcag
ccccagagaggagaacggattcccaagaacatggagcaatataatttaaatcatgatcat
tgcggcaatgggcttagcagccattttccctgtagtgagagccagcagcatctcaatgga
cagttcaaagggaggaatataatgcattacccaaatggtcatgccatttgtattgcaaat
ggacattgtatgaacttctccaatgcttatactcaaagagtatgtgatagagttccgata
gatggattttctcagaatgagaacaagaatagttacctgtgcaacactggaggaagaatg
catctggtttgtccaatgagtaagtctccatatgtggatcctcataaatcaggacatgaa
atctgggaagaattttcgatgagcttcactccagcagtgaaagaagtggtggaatttgca
aagcgtattcctgggttcagagatctctctcagcatgaccaggtcaaccttttaaaggct
gggacttttgaggttttaatggtacggttcgcatcattatttgatgcaaaggaacgtact
gtcacctttttaagtggaaagaaatatagtgtggatgatttacactcaatgggagcaggg
gatctgctaaactctatgtttgaatttagtgagaagctaaatgccctccaacttagtgat
gaagagatgagtttgtttacagctgttgtcctggtatctgcagatcgatctggaatagaa
aacgtcaactctgtggaggctttgcaggaaactctcattcgtgcactaaggaccttaata
atgaaaaaccatccaaatgaggcctctatttttacaaaactgcttctaaagttgccagat
cttcgatctttaaacaacatgcactctgaggagctcttggcctttaaagttcacccttaa

DBGET integrated database retrieval system